SecReT6
Protein ID: 238894415
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2400
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2308066..2310786 [+]
Producthypothetical protein
NoteTssI
UniProt IDC4X7H4
KEGG IDkpu:KP1_2400
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-66, Aligned region: 41..362
DUF2345 [PF10106], Evalue: 9.10E-43, Aligned region: 560..573
DUF2345 [PF10106], Evalue: 9.10E-43, Aligned region: 618..760
T6SS_Vgr [PF13296], Evalue: 2.20E-35, Aligned region: 496..599
T6SS_Vgr [PF13296], Evalue: 2.20E-35, Aligned region: 595..624
T6SS_Vgr [PF13296], Evalue: 2.20E-35, Aligned region: 636..661
Phage_base_V [PF04717], Evalue: 1.60E-16, Aligned region: 346..364
Phage_base_V [PF04717], Evalue: 1.60E-16, Aligned region: 396..489
Protein Sequence: 906 a.a.     [Download]
>gi|238894415|ref|YP_002919149.1| hypothetical protein KP1_2400 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MTRGQYPMSSVKSLLFSHNHHLLSVKGCEAGLDVLAFEGDEALSQPFRYRIEFTSADHAISKEMMLMKAA
SLTLQAPVAQGFGINVQQPVRVIQGVVTGFERLSTSRDETHYALTLQPRLALLNRSHQNAIYQDQSVPQI
VEKILRERHGLRGQDFLFSLTKTYPRREQVMQYGEDDLRFITRLLGEVGIWFRFTADTRLHIDVAEFCDS
QQGYEKGLTLPSVPPSGQQSAGVDAVWEMACRHRVVEQQVSTRDYNYREATADMNAQVDVTRGETTTFGE
AYHWGDNYLTAGNVHDRHPAPESGAFYARLRHERYLNGQTRMQATTSCPTLCPGQVLKVTGGEEVAGEFA
DGVLVTAMHSHARRDADFAVEFAGIPDSPDVGYRPEPGARPVMAGTLPARVTSTRENDTYGHIDKHGRYR
VNMLFDRARWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVT
IRNDKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAEKQPRGEGFELRTDSWGAIRAQ
KGIFISADGQVQAQGQVLDMEPAVSNLAEAREQMMSISGDAQKATANPADLQAQITLLEQQLTDLKKSVL
LVSAPEGIALTSGEHLQVSAGHNLIATAGKNADVSVVKNLFIGVGSALSVFVRKLGIRLIANQGPVQMQA
QNDLMALLARKEISIVSTEDEIKIIAKKKLTLNGGGSYIRLDANAIESATAGEYRTKAGYYGRQESASEK
VKMPVFPVMEPGEHSLRFAFPGADSVSQSMNWLINQPYSISDSAGKILSTGTVDTSGRFPKIVLPESDTL
NLIIGRETWSKEELSVSSTEDDSMEDFEDEAPDADLHLSEMGFEDDRTSALTESMISTLLSLTKDS
 
Nucleotide Sequence: 2721 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2308066-2310786 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
TTGACGAGGGGACAATATCCGATGAGTAGCGTGAAATCGTTGTTGTTCAGCCATAACCACCACCTGCTTT
CGGTGAAGGGATGTGAAGCCGGGCTTGATGTGCTGGCCTTCGAGGGCGATGAAGCCCTGAGCCAGCCGTT
CCGCTACCGTATTGAATTCACCAGCGCAGACCATGCCATCAGCAAAGAGATGATGCTGATGAAGGCAGCC
TCCCTGACGCTGCAGGCGCCGGTGGCTCAGGGCTTCGGCATCAATGTTCAGCAACCCGTGCGGGTGATCC
AGGGCGTGGTGACGGGGTTTGAACGGCTCAGTACCTCCAGGGATGAAACGCACTACGCGCTGACGCTTCA
GCCGCGCCTGGCGCTGCTTAACCGCTCGCACCAGAACGCCATTTACCAGGACCAGTCCGTTCCGCAGATT
GTGGAAAAAATCCTCCGCGAGCGCCACGGCCTGCGCGGTCAGGATTTTCTGTTCTCGCTGACAAAAACGT
ATCCGCGACGCGAGCAGGTGATGCAGTACGGCGAGGATGACCTGCGCTTTATCACCCGGCTGCTGGGTGA
GGTGGGGATCTGGTTTCGGTTTACCGCCGACACGCGGCTGCACATCGACGTCGCTGAGTTCTGCGACAGT
CAGCAGGGCTATGAGAAGGGGCTGACGTTGCCTTCGGTCCCGCCGTCAGGGCAGCAGTCGGCCGGGGTGG
ACGCGGTGTGGGAGATGGCATGTCGCCACCGCGTCGTGGAGCAGCAGGTCAGTACCCGCGACTACAACTA
CCGCGAGGCGACGGCGGACATGAACGCGCAGGTGGATGTCACCCGCGGGGAGACCACTACCTTTGGTGAG
GCTTACCACTGGGGAGATAACTACCTGACCGCGGGGAATGTCCATGACCGCCATCCGGCGCCGGAGTCCG
GGGCGTTTTACGCCCGGCTTCGGCATGAGCGTTATCTTAACGGCCAGACCCGGATGCAGGCCACCACCAG
CTGCCCGACGCTCTGCCCGGGACAGGTGCTGAAGGTCACCGGCGGAGAGGAGGTGGCCGGGGAGTTTGCT
GATGGCGTGCTCGTCACGGCGATGCACAGCCACGCCCGGCGCGATGCCGACTTTGCGGTGGAGTTTGCCG
GCATACCGGACAGCCCGGACGTCGGCTACCGGCCTGAGCCCGGCGCGCGTCCGGTGATGGCCGGGACGCT
GCCGGCCCGCGTGACCAGCACCCGGGAAAACGACACCTACGGGCATATCGACAAACACGGACGCTACCGG
GTGAATATGCTGTTTGACCGGGCGCGCTGGGAAACCGGTTTCGAGAGCCTGTGGGTCCGCCAGTCGCGGC
CGTATGCCGGAGACACCTACGGCCTGCACCTGCCGCTGCTGGCCGGGACGGAGGTGGCGATTGGCTTTGA
GGATGGTAACCCTGACCGGCCGTATATCGCGGGCGTGCTGCACGACTCGGCGCACGGCGACCACGTCACC
ATCCGCAATGACAAACGTAACGTCCTGCGCACCCCGGCCAACAACAAAATCCGCCTCGACGATGAGCGCG
GAAAAGAGCATATCAAGGTCTCGACGGAGTACGGCGGTAAGAGCCAGCTGAACCTCGGCCATCTCGTGGA
TGCTGAAAAGCAGCCGCGCGGCGAAGGCTTTGAGCTGAGAACCGACAGCTGGGGCGCTATCCGGGCACAG
AAAGGGATATTTATCAGCGCGGACGGACAGGTGCAGGCTCAGGGGCAGGTGCTGGATATGGAGCCGGCGG
TCAGCAATCTGGCCGAAGCCCGGGAGCAGATGATGTCCATCTCCGGTGACGCGCAGAAGGCGACCGCGAA
CCCGGCCGATCTCCAGGCGCAAATTACCCTGCTGGAGCAGCAGCTGACAGACCTCAAAAAATCGGTACTG
CTGGTCAGCGCGCCGGAGGGGATAGCGCTGACCAGCGGGGAGCACCTGCAGGTCTCAGCCGGGCATAACC
TGATTGCCACAGCCGGAAAGAATGCAGACGTCAGCGTGGTGAAAAATCTGTTCATCGGGGTGGGCAGTGC
GCTGAGCGTGTTTGTGCGAAAGCTTGGGATCAGGCTGATAGCGAATCAGGGACCGGTACAGATGCAGGCG
CAGAATGACCTGATGGCGCTGCTTGCCCGGAAGGAAATCAGCATTGTCAGCACGGAGGATGAAATCAAAA
TCATCGCGAAGAAGAAGCTGACCCTGAATGGTGGGGGGAGTTATATCAGACTTGATGCAAATGCGATTGA
ATCTGCTACTGCAGGCGAATATCGCACGAAAGCAGGATATTACGGGCGTCAGGAAAGCGCTTCTGAAAAA
GTCAAAATGCCTGTATTTCCTGTAATGGAGCCTGGAGAGCACAGTTTACGTTTTGCTTTTCCAGGTGCGG
ATAGTGTCAGCCAGAGTATGAACTGGCTGATAAATCAGCCGTACAGTATTTCTGATAGCGCTGGAAAAAT
TCTGTCTACCGGAACAGTAGACACTTCAGGTCGTTTTCCCAAAATAGTACTTCCTGAAAGCGATACATTA
AATTTAATCATTGGCCGAGAAACTTGGAGTAAAGAGGAGCTTTCTGTCTCATCAACTGAAGACGACAGTA
TGGAGGATTTTGAGGATGAAGCACCTGATGCCGATCTTCATTTAAGTGAAATGGGTTTTGAAGATGATAG
AACATCAGCATTGACTGAATCAATGATTTCAACTTTATTAAGTTTAACAAAGGATAGTTGA