SecReT6
Protein ID: 238894428
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2414
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2321926..2323524 [+]
Producthypothetical protein
NoteTssA
UniProt IDC4X7I7
KEGG IDkpu:KP1_2414
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.70E-21, Aligned region: 68..126
ImpA-rel_N [PF06812], Evalue: 5.70E-21, Aligned region: 302..314
Protein Sequence: 532 a.a.     [Download]
>gi|238894428|ref|YP_002919162.1| hypothetical protein KP1_2414 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MSILQNLVAASQLDESVLRQQARSRQAQWQSWLSPISDSQPTGSDPGYDDDFQRIREEVNKISGVDTVLI
CQLAGQLLATTKDIRIVTYYCWARLHQDGEAGLADGLELLAGLLQRYGMQLYPQRDRSRKAAIEWLAGTR
ILDSLSLFPEVVREDARRTVGALLLIDDCLTTEPETSRPDLQALWGALESRLIKGGGVDAVVPQNVGNRG
LAQTASRMAEYEAPVLSNITSGQDLLAQARTLTAYLRVQPDGWLAAHRLMKSLRHDTLTIIPAPDAEGKT
RIEPPRADQRAMLKRLYLQQSWSEILEQADSTFSRGANHLWLDLQWYIHQALVRSGQDVLADIIIADLKG
LLRRLTGLETLAFNDGTPFADEVTLNWINQSVLDDMSVWQDEPVSAASGADNDILALEPEALEKADTDGL
DAALHWIQTRPGTESTKEKWLLRLLMARVAEQKGKNDLALYLLRELDDAAGSITLTQWIPALLFEIKSRR
LRLLRMKATRSESEKLRLQPEMDQLLAGLIALDPASSAVLCG
 
Nucleotide Sequence: 1599 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2321926-2323524 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAGCATTTTACAAAATTTGGTTGCCGCCAGTCAGTTGGATGAAAGCGTACTGCGCCAGCAGGCCCGGT
CACGTCAGGCGCAGTGGCAGTCCTGGCTTTCGCCAATCAGTGATAGCCAGCCCACCGGGAGCGATCCGGG
CTATGACGATGATTTTCAGCGTATCCGCGAGGAGGTCAATAAGATCTCCGGTGTCGATACCGTACTGATT
TGCCAGTTGGCTGGACAGTTACTGGCAACAACAAAAGATATCCGGATTGTTACCTATTACTGCTGGGCCC
GTTTGCACCAGGACGGGGAAGCTGGCTTGGCCGATGGGCTGGAGCTGCTGGCAGGCTTGCTGCAACGATA
TGGTATGCAGCTTTATCCGCAGCGCGACCGTAGCCGCAAAGCAGCCATCGAGTGGCTGGCGGGTACTCGT
ATCTTAGACAGTCTTTCACTTTTTCCAGAAGTTGTGCGGGAGGACGCAAGGCGTACCGTCGGCGCGCTGC
TTCTCATTGATGATTGTCTGACGACAGAACCAGAAACATCACGGCCAGATCTGCAAGCACTCTGGGGTGC
ACTGGAGTCTCGTTTGATAAAGGGCGGGGGAGTCGATGCGGTGGTGCCGCAGAACGTCGGAAACCGGGGG
CTGGCTCAAACCGCTTCACGCATGGCTGAATACGAAGCGCCGGTTCTCAGTAACATCACCTCCGGTCAGG
ATCTGCTGGCCCAGGCGCGAACCCTGACAGCATATCTGCGTGTTCAACCCGATGGCTGGCTTGCCGCACA
TCGGCTAATGAAAAGCCTTCGTCATGACACCTTGACAATCATCCCTGCGCCTGATGCTGAAGGAAAAACA
CGTATCGAGCCTCCCAGAGCAGATCAGCGTGCCATGCTCAAGCGGCTGTACCTGCAACAGAGCTGGTCGG
AGATACTGGAACAGGCGGACAGTACCTTCTCACGTGGCGCTAACCACCTCTGGCTTGACCTGCAATGGTA
TATCCATCAGGCGCTGGTGAGGTCGGGTCAGGATGTGCTGGCCGATATTATAATTGCCGATCTGAAAGGA
TTGCTGCGCCGTCTCACCGGGCTTGAAACATTAGCTTTTAACGACGGCACACCCTTTGCCGATGAGGTCA
CGCTGAACTGGATAAATCAGAGTGTCCTCGACGATATGTCCGTCTGGCAGGATGAGCCAGTATCGGCTGC
CAGCGGCGCTGATAACGACATTCTGGCCCTTGAACCTGAAGCGCTCGAGAAGGCTGACACTGACGGTCTC
GATGCTGCACTCCACTGGATTCAGACGCGCCCGGGCACTGAATCCACTAAAGAAAAATGGCTGTTGCGCC
TGCTTATGGCCCGCGTGGCCGAACAAAAGGGGAAGAATGACCTCGCGCTCTATCTTCTGCGAGAACTCGA
CGATGCGGCGGGATCAATCACCCTCACGCAGTGGATCCCAGCCCTGTTGTTCGAGATTAAATCGCGACGG
CTCAGGCTACTGCGCATGAAAGCCACGCGCAGCGAGAGTGAAAAGTTACGATTGCAACCGGAGATGGATC
AATTGCTGGCAGGTCTGATTGCGCTCGATCCAGCCAGTAGCGCGGTGCTTTGCGGCTAA