SecReT6
Protein ID: 238894429
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2415
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2323555..2324610 [+]
Producthypothetical protein
NotePAAR
UniProt IDC4X7I8
KEGG IDkpu:KP1_2415
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 2.10E-29, Aligned region: 193..304
PAAR_motif [PF05488], Evalue: 2.70E-09, Aligned region: 10..74
Protein Sequence: 351 a.a.     [Download]
>gi|238894429|ref|YP_002919163.1| hypothetical protein KP1_2415 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MAAKGFYLVQGDRTTCGGRITTGAEDHTLFDKPVAREQDSVTCGKHAGLYKIAGGIDNDTIHGRRMAGTL
DSCSTCPCKAKFIPSMMNDTYEKGGECITTLFSLDGLMASLQEPYKNLHPENKTERQCTHTDGAIKVAEY
ILSEIKANVRSDTAETIRYLIDEDFIIKRLTEWNKLPFYARLGPPPKTDLLAAMAIWYQTVKTGSIWDHK
PKIRDFFSSVAVARPLPRKGKSSKSYYHKFKQHDYFYDVWSNIHYGYVGRSVGFSEAILLKGSTWEQNMT
PGAMGDDTMDDITSMKIGFNLFYEHGKFAETLTADNILCVLETTPGAHLPHSRENHWCWNTDNPEKSDES
F
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2323555-2324610 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGCAGCAAAAGGTTTTTATCTGGTACAGGGAGACAGAACGACCTGCGGCGGAAGAATCACTACAGGCG
CAGAAGATCACACTCTGTTTGATAAACCTGTTGCCCGGGAGCAGGACAGCGTCACTTGCGGAAAGCACGC
AGGGCTATACAAGATTGCCGGTGGCATCGACAACGATACCATTCATGGCCGGCGAATGGCCGGAACCCTC
GACAGCTGTAGTACTTGCCCCTGTAAGGCGAAGTTTATTCCATCAATGATGAATGATACTTATGAGAAAG
GAGGTGAATGCATAACTACTTTATTTTCACTCGATGGGCTTATGGCATCTTTACAGGAACCCTATAAGAA
TCTTCATCCAGAAAATAAGACTGAACGACAGTGTACTCACACAGATGGGGCGATTAAAGTTGCAGAATAT
ATACTAAGTGAAATAAAGGCGAATGTCAGAAGCGATACGGCAGAAACAATACGATATTTAATCGACGAAG
ATTTTATAATAAAAAGACTTACTGAATGGAATAAACTTCCCTTTTATGCAAGGCTGGGGCCGCCCCCTAA
AACAGATTTACTTGCTGCAATGGCTATTTGGTATCAGACCGTGAAAACAGGTTCAATCTGGGATCATAAA
CCGAAGATCCGCGATTTTTTTTCATCCGTTGCAGTAGCACGACCACTTCCCAGGAAAGGAAAATCATCAA
AGTCTTATTATCATAAGTTTAAACAGCATGATTATTTTTATGATGTTTGGTCAAACATACATTATGGTTA
TGTTGGACGTAGTGTCGGTTTTTCTGAAGCAATTCTCTTGAAAGGGTCCACTTGGGAACAAAACATGACG
CCAGGTGCCATGGGGGATGATACCATGGATGACATTACTAGCATGAAAATAGGGTTTAATCTATTTTATG
AACATGGGAAATTTGCTGAGACGTTGACGGCAGATAATATTCTTTGCGTTTTAGAAACAACACCTGGCGC
GCACCTTCCTCACTCAAGAGAAAATCATTGGTGCTGGAATACAGATAATCCAGAAAAAAGTGACGAATCA
TTTTGA