SecReT6
Protein ID: 238894433
SecReT6 ID344
T6SS typei2
Gene symbol-
Locus tagKP1_2421
StrainKlebsiella pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T6SS(s) in this replicon]
Location [Strand]2327935..2328477 [+]
Producthypothetical protein
NoteTssJ
UniProt IDC4X7J2
KEGG IDkpu:KP1_2421
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-35, Aligned region: 17..171
Protein Sequence: 180 a.a.     [Download]
>gi|238894433|ref|YP_002919167.1| hypothetical protein KP1_2421 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MLRISLTKTACLLPLLALCLSGCGLTQRVSEGTKSAFNAVFYKKINTLHLDFTAREALNTDARENHSLSE
PVVVRIYQLKDRQTFDRLVYQQLLEEGDILLAADLLASRDVVIGPGGDASLNMPLEAEATFVAVVGLFRH
PDTQRNTWKQVLAREELDPDKPRIFTAEHNQLRLRPEAAK
 
Nucleotide Sequence: 543 bp     [Download]
>gi|238892256|ref|NC_012731.1|:2327935-2328477 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
GTGTTACGTATAAGTTTGACTAAAACCGCCTGTCTGCTGCCCCTGCTTGCGCTTTGCCTGAGCGGATGCG
GACTCACCCAGCGCGTCTCGGAGGGAACAAAGTCTGCCTTCAACGCCGTTTTTTATAAGAAAATTAATAC
GCTGCATCTGGACTTTACCGCGCGCGAAGCGCTCAACACCGATGCCAGAGAGAATCACTCGCTCTCTGAA
CCGGTGGTGGTGCGCATCTATCAGCTTAAAGATCGCCAGACCTTTGACCGGCTGGTTTACCAGCAGCTGC
TGGAGGAGGGGGATATTCTGCTCGCCGCCGATCTCCTCGCCAGTCGCGATGTGGTGATCGGTCCCGGAGG
GGACGCCAGTCTGAATATGCCGCTGGAAGCGGAGGCGACGTTCGTGGCGGTTGTCGGCCTGTTCCGCCAT
CCGGACACACAAAGAAATACCTGGAAGCAGGTGCTGGCGCGTGAGGAATTGGATCCGGACAAGCCGCGCA
TTTTCACCGCCGAACACAACCAGCTACGGCTCAGGCCTGAAGCGGCGAAGTAA