SecReT6
Protein ID: 238920625
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2737
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2631752..2632264 [+]
Producthypothetical protein
NoteTssB
UniProt IDO52407, C5B8P5
KEGG IDeic:NT01EI_2737
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-59, Aligned region: 10..163
Protein Sequence: 170 a.a.     [Download]
>gi|238920625|ref|YP_002934140.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MASESKQHTLDRVRSPRVQITYDVEIGDAQEMKELPFVMGVLGDYSGQPATPLPKLKERKFVSIDRDNFN
DVIKGIHPHLSFRTENTLAGDDSQLSVELHFQSMADFTPERIAAQVEPLRKLMNIRSRLSDLKNKMYSNE
RLGEVLQGIIEDTEKLQNLGKETGFSEEQQ
 
Nucleotide Sequence: 513 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2631752-2632264 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGGCAAGTGAAAGCAAGCAGCATACTTTGGATCGGGTCCGCTCGCCAAGAGTGCAGATTACCTATGATG
TTGAAATTGGCGATGCGCAGGAGATGAAGGAGCTGCCATTTGTCATGGGGGTTCTCGGTGACTATTCAGG
GCAACCGGCGACCCCGCTTCCCAAGCTGAAAGAACGCAAATTCGTTTCGATTGATCGTGACAACTTCAAC
GATGTTATCAAAGGGATACATCCACATCTGTCATTCCGCACTGAAAATACCCTGGCAGGAGATGACAGCC
AGCTGTCGGTGGAGCTGCATTTTCAAAGTATGGCGGATTTCACTCCTGAGCGAATAGCGGCACAGGTCGA
ACCACTACGCAAGCTGATGAATATCCGCAGCCGACTCTCCGATCTGAAAAACAAGATGTACAGCAACGAG
CGCCTGGGTGAGGTATTGCAGGGCATCATTGAAGATACCGAAAAACTGCAAAATCTGGGTAAAGAGACCG
GTTTTAGTGAGGAACAGCAATAA