SecReT6
Protein ID: 238920626
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2738
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2632264..2633751 [+]
Producthypothetical protein
NoteTssC
UniProt IDC5B8P6, O52406
KEGG IDeic:NT01EI_2738
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-191, Aligned region: 67..490
Protein Sequence: 495 a.a.     [Download]
>gi|238920626|ref|YP_002934141.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MSEQNLPESAAVESAAPEDSLLDSIIAETRMARSDLERERARDLLGEWVSEVLSGTVTVSGDVLASIEAR
IAQIDALLSAQLSTIMHEPAFQKLEGSWRGLHYLVHQSETGTGLKIRMLNVSRKDLIRDFKSAAEFDQSA
LFKKVYEEEYGTFGGAPFAAMIGDYEFSNHPEDLFLLEEISHVAAAAHAPFLSAASAGMFGLDSLTELSI
PRDLAKGFDTVEYAKWKSLRQSEDARYIALALPHVLGRLPYGAATVPVEAFNFEEDVNGKEHGKYLWLNA
AYALGTRLTQAYAKYGWCAAIRGVEGGGLVEGLPAHTFTTDDGEVELKCPTEVAITDRREKELADLGFIA
LTHCKGTDYAAFFSTQSAQKPKEYDSDSANANARIACQLQYIMATSRFAHYLKSMVRDKLGSFMSRSECE
YFLNQWISNYVVGSDDAGQDIKAKYPLREARIDVSDIPGKPGFYKAVAYLKPHFQLEGLTASLRLVADLP
PPAQG
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2632264-2633751 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAGCGAACAGAACTTGCCAGAAAGTGCCGCTGTCGAGAGCGCGGCTCCAGAGGACAGCCTGCTGGATA
GCATCATTGCTGAAACCCGGATGGCACGCAGTGACCTGGAGAGAGAGCGGGCGCGGGACCTGTTGGGGGA
ATGGGTAAGTGAGGTTCTGTCGGGAACGGTGACAGTTTCCGGTGACGTACTGGCCAGTATTGAGGCACGT
ATTGCCCAGATCGATGCGCTGCTCTCCGCCCAGCTGTCCACCATTATGCATGAGCCGGCTTTCCAAAAGC
TGGAAGGGTCATGGCGTGGACTGCATTACCTGGTACATCAAAGCGAAACCGGTACCGGCCTGAAAATCCG
CATGCTGAATGTCAGCCGAAAAGATCTGATCCGCGACTTTAAGAGTGCCGCCGAGTTTGATCAGAGCGCC
CTGTTCAAGAAAGTCTATGAGGAGGAGTACGGCACCTTTGGTGGTGCCCCCTTTGCAGCCATGATCGGGG
ATTATGAGTTCAGCAACCACCCGGAGGATCTGTTTCTGCTGGAGGAGATCTCACACGTTGCGGCGGCAGC
CCATGCTCCCTTCCTCTCTGCCGCCAGCGCAGGAATGTTCGGACTGGATAGCCTGACAGAGCTGTCGATC
CCCAGGGATCTGGCCAAAGGCTTTGATACGGTTGAGTATGCCAAGTGGAAATCGCTGCGCCAGTCGGAGG
ATGCCCGCTATATCGCCCTGGCCCTGCCCCACGTGCTTGGCCGACTGCCTTACGGTGCCGCGACGGTACC
GGTAGAGGCATTCAATTTTGAGGAAGATGTCAACGGCAAGGAGCATGGCAAATATCTGTGGCTGAATGCG
GCCTATGCGCTGGGTACCCGCCTGACTCAGGCCTATGCCAAATATGGCTGGTGCGCCGCCATCCGGGGAG
TCGAAGGAGGTGGTCTGGTGGAGGGACTGCCGGCGCACACCTTTACTACCGATGATGGCGAAGTAGAGCT
CAAGTGTCCCACCGAAGTGGCCATTACCGATCGCCGGGAGAAAGAGTTGGCCGACCTGGGATTTATCGCC
CTGACCCACTGTAAGGGTACCGACTATGCCGCATTCTTTTCGACCCAGTCGGCACAAAAGCCCAAGGAAT
ATGACAGTGACTCAGCTAATGCCAACGCCAGGATCGCCTGCCAGCTGCAATATATTATGGCCACCTCGCG
CTTTGCCCATTATTTAAAATCGATGGTCCGCGACAAGCTCGGCAGCTTTATGAGCCGTAGCGAATGTGAA
TACTTTCTCAATCAGTGGATCAGTAATTATGTGGTCGGTTCAGATGATGCAGGCCAGGATATTAAGGCGA
AATACCCATTACGGGAAGCCCGTATTGATGTCAGCGATATTCCAGGTAAACCGGGGTTCTATAAGGCAGT
GGCCTATTTAAAACCCCATTTCCAGCTGGAGGGGCTGACCGCATCTTTACGTTTGGTCGCCGATCTGCCG
CCACCGGCGCAAGGCTAA