SecReT6
Protein ID: 238920627
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2739
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2633938..2634312 [+]
Producthypothetical protein
NoteTssD
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-22, Aligned region: 2..98
Protein Sequence: 124 a.a.     [Download]
>gi|238920627|ref|YP_002934142.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MESGTQGLNTGKATMSVFRITKWMDCASVKLASAAVQGQNFPSLEVEICTQAGDKFAFCIYKFTNVAISS
YDCSGASGGSDRPQETIDFAYKEVTWEYIPQDQSGKAGSKIGPEGWSLITNQKK
 
Nucleotide Sequence: 375 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2633938-2634312 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGGAGAGCGGTACCCAGGGTCTGAATACCGGTAAGGCCACAATGTCGGTATTCCGTATAACCAAATGGA
TGGACTGCGCCAGTGTCAAGCTGGCCTCGGCCGCCGTTCAGGGCCAGAACTTTCCCTCGCTGGAAGTGGA
GATTTGTACCCAGGCTGGCGATAAGTTCGCCTTCTGTATCTATAAATTTACTAATGTAGCCATCTCCAGC
TATGACTGCTCCGGGGCCTCTGGCGGAAGCGACCGCCCGCAGGAAACCATTGATTTCGCCTATAAGGAAG
TGACTTGGGAATATATTCCCCAGGATCAGAGCGGTAAGGCGGGCAGTAAAATTGGGCCCGAGGGCTGGAG
TCTTATTACCAACCAGAAGAAGTAA