SecReT6
Protein ID: 238920629
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2741
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2635662..2636138 [+]
Producthypothetical protein
NoteTssE
UniProt IDC5B8P9, O52404
KEGG IDeic:NT01EI_2741
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.70E-21, Aligned region: 35..141
L27_1 [PF09058], Evalue: 0.0035, Aligned region: 38..53
L27_1 [PF09058], Evalue: 0.0035, Aligned region: 83..113
L27_1 [PF09058], Evalue: 0.0035, Aligned region: 141..149
Protein Sequence: 158 a.a.     [Download]
>gi|238920629|ref|YP_002934144.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MILHRIFRPSVLDRLFDDFPQEGTERTSDRRYELAHFRWTVRRDVEDILNSRSALALDISQWPELEKSPL
NYGLPDCSNLSAANAEDREWIRQHIERVIDLFEPRLRQVRVQIHLDEKTGISQMIFRIEALLDVEPSPEP
VVFDAVLDVSTQLYRIDR
 
Nucleotide Sequence: 477 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2635662-2636138 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGATCCTTCATCGTATCTTCCGCCCTTCCGTGCTGGATCGTTTGTTCGATGATTTCCCGCAGGAGGGAA
CAGAACGGACATCAGATCGCCGGTATGAACTGGCCCATTTTCGCTGGACCGTCAGACGGGATGTGGAAGA
TATTCTGAATTCGCGATCCGCGCTGGCACTGGATATAAGCCAGTGGCCTGAGCTGGAAAAATCCCCCCTG
AATTACGGCCTGCCGGACTGCTCAAACCTGAGTGCCGCCAATGCCGAGGATCGGGAGTGGATCCGCCAGC
ATATCGAACGAGTGATTGACCTGTTTGAACCCCGGCTACGTCAGGTCCGGGTTCAAATCCATCTGGATGA
GAAAACCGGCATCAGCCAGATGATATTCAGGATCGAGGCATTACTGGACGTGGAGCCCTCTCCAGAGCCG
GTGGTATTTGATGCCGTTCTGGATGTTTCAACACAGCTGTACCGAATAGACAGGTGA