SecReT6
Protein ID: 238920630
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2742
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2636142..2637983 [+]
Producthypothetical protein
NoteTssF
UniProt IDC5B8Q0
KEGG IDeic:NT01EI_2742
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.40E-214, Aligned region: 4..611
Protein Sequence: 613 a.a.     [Download]
>gi|238920630|ref|YP_002934145.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MAELLPYYNRELAFLRQLGREFASQYPKVAGRLLLEEGVSEDPHVERLIEAVAFLCARVHHKIDEQFPEI
TNALLGILYPHYLRPIPSISLVQFSVDPAQTNLSGPLRLPRHTSLLSRQVDGMACRFRTTYPVEIWPVSV
IHACFSPARQTSLSVQQQGSAGLICIQLQAHPGHHLNTLGMDRLRFFLQGEPAVVHTLYELLFNNVTKVV
LRSGAEEWTLPASIISPVGFDEDENLFDYDARSSQAYRLLHEYFVFPDKFLFFDMTGLLQATPLPEACQE
IDLLIHLSEFEREGRLTKLTDTIDASTFRLGCSPVVNLFRQRAEPLQITHRKTEYQIIPDIRRPWGMEVY
SVDAVSKQVKNDGQEKTKLYRPLFGLHHANDSEPQRVFWMENRRGGIRGDDPGKDVYLSLVDLDFDPNQS
SSETLSIDVTCTNREFPSLLPFGGDQGDFEVDGGSLVTRIHCLRKPTSTLRPAHGRAAMWRLISHLNLNL
LSITGENEEATEAFRELLGLYNFSDSPALRQQIAGIVSINSQPATARLCSRNQAAVVRGIEITLVLDESQ
FEGAGVYLFSAVVERFVSQYSAINSFTRLHVRTQQREQALKRWPPRAGKAVLS
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2636142-2637983 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGGCCGAGTTATTGCCCTACTATAACCGGGAACTGGCGTTCCTCCGCCAGTTGGGACGTGAGTTCGCCT
CCCAGTATCCCAAGGTAGCCGGCCGCCTTCTGCTGGAGGAGGGAGTATCGGAAGATCCTCATGTCGAGCG
GCTGATCGAAGCCGTGGCATTTCTCTGCGCCCGCGTGCATCACAAGATAGATGAGCAGTTCCCCGAAATA
ACCAATGCGTTGCTGGGGATCCTCTATCCCCATTACCTGCGCCCGATTCCCTCCATATCTCTGGTCCAGT
TTTCGGTCGATCCGGCACAGACCAACTTGTCAGGCCCGCTGCGGCTGCCACGACATACCAGCCTGCTATC
CCGCCAGGTGGATGGCATGGCATGCCGGTTCCGGACCACCTACCCGGTGGAAATTTGGCCGGTGTCAGTC
ATCCATGCCTGCTTCTCCCCCGCGCGACAAACCAGCCTGTCAGTACAACAGCAGGGAAGCGCCGGTCTGA
TCTGTATTCAGCTGCAAGCCCATCCGGGACATCATCTGAATACCCTGGGAATGGATAGACTGCGTTTCTT
TCTTCAGGGTGAGCCTGCCGTGGTGCACACCCTGTATGAGCTGCTGTTCAACAATGTGACCAAGGTGGTC
CTGCGCTCCGGGGCGGAGGAGTGGACCCTGCCTGCCAGCATCATCTCACCGGTTGGATTCGACGAGGATG
AGAACCTGTTTGACTACGATGCCCGCTCGTCCCAGGCCTACCGCCTACTGCACGAATACTTTGTTTTTCC
TGACAAGTTCCTGTTTTTTGATATGACCGGGTTGCTGCAGGCAACTCCGCTGCCTGAGGCCTGCCAGGAG
ATCGATCTGTTGATCCATCTGTCAGAGTTCGAACGGGAGGGACGCCTGACCAAACTGACCGATACTATCG
ATGCCTCAACGTTCCGGCTGGGATGCAGCCCGGTGGTCAACCTGTTCCGGCAGCGGGCAGAGCCTTTGCA
GATAACCCACCGTAAAACCGAGTACCAAATTATTCCCGATATACGCCGTCCCTGGGGCATGGAGGTCTAT
TCGGTCGATGCCGTCAGTAAACAGGTCAAGAATGATGGGCAAGAGAAGACGAAGCTCTACCGTCCCCTGT
TCGGCCTGCATCACGCCAACGACAGTGAGCCACAGCGGGTATTCTGGATGGAAAATCGCCGTGGCGGGAT
CCGCGGGGATGACCCGGGCAAGGACGTCTATTTATCCCTGGTGGATTTGGATTTTGACCCCAATCAGTCA
TCATCGGAAACCCTGAGCATCGATGTGACCTGCACTAACCGAGAATTTCCCTCCCTGCTGCCCTTCGGCG
GTGACCAAGGGGACTTCGAGGTAGACGGAGGCTCTCTCGTCACCCGGATCCACTGCCTGCGCAAGCCGAC
ATCGACCCTGCGCCCTGCCCACGGCAGGGCAGCCATGTGGCGGCTGATCTCCCACCTGAACCTGAACCTG
CTCTCCATCACCGGTGAAAACGAGGAGGCAACCGAGGCATTCAGGGAGCTGCTCGGACTGTATAACTTCA
GCGACTCCCCCGCCCTGCGTCAGCAGATTGCCGGCATTGTCAGTATCAACAGCCAGCCGGCGACGGCGCG
CCTGTGCAGCCGGAATCAGGCGGCGGTGGTTCGGGGCATCGAAATTACACTGGTGCTGGATGAGAGCCAA
TTTGAGGGAGCCGGGGTGTATCTGTTCAGTGCCGTGGTAGAGCGATTCGTCAGCCAGTATAGCGCCATCA
ACAGTTTTACCCGCCTGCATGTACGCACCCAGCAGCGGGAACAAGCGCTCAAGCGCTGGCCGCCGCGGGC
GGGTAAGGCGGTGCTGTCATGA