SecReT6
Protein ID: 238920631
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2743
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2637980..2639005 [+]
Producthypothetical protein
NoteTssG
UniProt IDC5B8M3
KEGG IDeic:NT01EI_2743
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.60E-101, Aligned region: 16..318
Protein Sequence: 341 a.a.     [Download]
>gi|238920631|ref|YP_002934146.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MSAPQNRQSVLEQLYARPYDFDFFQAVRILELQQLRCGCQELPLRFRTHLSLATPASSIYALQPPVADQP
QVMTINFMGLTGPSGALPTRYTEMLLERRLQHRDQTAHHFFDLLNHRLITLFYQAWRKHQATADLACGLQ
ADWRQMLLSLAGLGTPGLQNRLIKDGVNDDVFAYYAGRFGARSLSEEGLRTLLTEYFSVPVEIQPFQGQW
LKLDESDVLALGRQNCTLGEWPVLGRQVWDAQSQFRIRLGPMNYKQFQAFLPGGKDFRALTKLVRFSIEI
AVTFDIQLVLDAREVPPCTLGDSQAGAARPGWIGWLGERPSRLGDADDVVLQEPRDRLHAR
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2637980-2639005 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAGCGCCCCCCAGAACCGACAGTCCGTGCTGGAGCAGCTGTATGCCCGGCCCTATGACTTCGATTTTT
TTCAGGCCGTCAGGATACTGGAGCTGCAGCAGTTAAGGTGTGGCTGCCAGGAGCTTCCGCTGCGCTTCCG
TACCCATCTCTCCCTGGCTACCCCGGCCAGCAGTATTTATGCGCTGCAGCCCCCCGTAGCAGATCAGCCG
CAGGTCATGACCATCAACTTCATGGGACTGACCGGCCCCTCTGGGGCATTACCGACACGGTATACCGAGA
TGCTGCTGGAGCGACGCCTGCAGCATCGGGATCAGACCGCTCACCATTTTTTTGATCTGCTCAACCACCG
TCTGATCACTCTGTTTTACCAGGCGTGGCGCAAACATCAGGCGACGGCTGATCTGGCCTGTGGCCTGCAG
GCCGATTGGCGTCAGATGCTGCTCTCCCTGGCCGGTCTGGGCACGCCGGGACTACAAAACCGGCTGATAA
AAGATGGTGTCAATGATGATGTCTTTGCCTATTACGCCGGGCGGTTCGGCGCACGCTCGCTCAGCGAGGA
GGGACTGCGCACACTGCTGACAGAGTATTTTTCCGTACCGGTTGAGATCCAGCCCTTTCAGGGACAGTGG
CTGAAGCTGGATGAGTCGGATGTCCTGGCTCTGGGGCGTCAGAACTGCACTCTGGGAGAGTGGCCGGTAC
TGGGCCGGCAGGTATGGGATGCCCAAAGCCAGTTTAGGATCCGCCTCGGGCCGATGAACTATAAGCAGTT
TCAGGCATTTTTACCGGGGGGAAAGGACTTTCGGGCACTGACCAAGTTGGTCCGTTTTTCCATTGAAATC
GCCGTAACGTTCGATATTCAGCTGGTACTGGACGCCCGTGAGGTACCGCCCTGCACACTGGGTGATAGCC
AGGCCGGAGCGGCCCGCCCCGGATGGATTGGCTGGCTGGGAGAGCGCCCCTCCAGACTGGGCGATGCCGA
CGACGTGGTATTACAGGAGCCGAGGGACAGGCTGCACGCGCGATAA