SecReT6
Protein ID: 238920632
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2744
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2639125..2641746 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC5BAE2
KEGG IDeic:NT01EI_2744
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.30E-40, Aligned region: 219..323
AAA_2 [PF07724], Evalue: 1.30E-40, Aligned region: 598..765
AAA [PF00004], Evalue: 7.00E-19, Aligned region: 219..350
AAA [PF00004], Evalue: 7.00E-19, Aligned region: 604..688
AAA_5 [PF07728], Evalue: 1.00E-14, Aligned region: 219..251
AAA_5 [PF07728], Evalue: 1.00E-14, Aligned region: 603..720
ClpB_D2-small [PF10431], Evalue: 2.20E-13, Aligned region: 775..845
AAA_16 [PF13191], Evalue: 7.10E-09, Aligned region: 196..241
AAA_16 [PF13191], Evalue: 7.10E-09, Aligned region: 429..532
AAA_16 [PF13191], Evalue: 7.10E-09, Aligned region: 599..648
AAA_16 [PF13191], Evalue: 7.10E-09, Aligned region: 668..691
AAA_16 [PF13191], Evalue: 7.10E-09, Aligned region: 760..802
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 218..315
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 348..385
AAA_22 [PF13401], Evalue: 7.50E-09, Aligned region: 601..647
Clp_N [PF02861], Evalue: 6.50E-07, Aligned region: 24..74
Clp_N [PF02861], Evalue: 6.50E-07, Aligned region: 108..128
AAA_25 [PF13481], Evalue: 2.70E-05, Aligned region: 219..279
AAA_25 [PF13481], Evalue: 2.70E-05, Aligned region: 274..313
AAA_25 [PF13481], Evalue: 2.70E-05, Aligned region: 343..379
AAA_25 [PF13481], Evalue: 2.70E-05, Aligned region: 601..625
Sigma54_activat [PF00158], Evalue: 2.90E-05, Aligned region: 215..234
Sigma54_activat [PF00158], Evalue: 2.90E-05, Aligned region: 603..703
AAA_19 [PF13245], Evalue: 3.20E-05, Aligned region: 219..240
AAA_19 [PF13245], Evalue: 3.20E-05, Aligned region: 601..625
AAA_14 [PF13173], Evalue: 3.70E-05, Aligned region: 219..353
AAA_14 [PF13173], Evalue: 3.70E-05, Aligned region: 602..684
AAA_17 [PF13207], Evalue: 8.40E-05, Aligned region: 219..284
AAA_17 [PF13207], Evalue: 8.40E-05, Aligned region: 602..639
IstB_IS21 [PF01695], Evalue: 9.40E-05, Aligned region: 204..279
IstB_IS21 [PF01695], Evalue: 9.40E-05, Aligned region: 603..622
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 219..239
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 602..643
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 219..287
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 605..628
NACHT [PF05729], Evalue: 0.00016, Aligned region: 219..246
NACHT [PF05729], Evalue: 0.00016, Aligned region: 603..628
NACHT [PF05729], Evalue: 0.00016, Aligned region: 805..832
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 211..235
AAA_29 [PF13555], Evalue: 0.0011, Aligned region: 601..628
Hpr_kinase_C [PF07475], Evalue: 0.0032, Aligned region: 219..231
Hpr_kinase_C [PF07475], Evalue: 0.0032, Aligned region: 601..622
DUF815 [PF05673], Evalue: 0.0056, Aligned region: 213..294
DUF815 [PF05673], Evalue: 0.0056, Aligned region: 603..643
DUF2075 [PF09848], Evalue: 0.0059, Aligned region: 219..321
DUF2075 [PF09848], Evalue: 0.0059, Aligned region: 370..386
DUF2075 [PF09848], Evalue: 0.0059, Aligned region: 461..486
DUF2075 [PF09848], Evalue: 0.0059, Aligned region: 602..629
RNA_helicase [PF00910], Evalue: 0.0085, Aligned region: 220..241
RNA_helicase [PF00910], Evalue: 0.0085, Aligned region: 604..625
RNA_helicase [PF00910], Evalue: 0.0085, Aligned region: 700..722
Protein Sequence: 873 a.a.     [Download]
>gi|238920632|ref|YP_002934147.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MNTDLKALTGKMNQTCHQALEAAAGLCLSRGHHEVEIEHVLLKLLETGNTDLDHLLQHYGIDAGRFQRDV
EQALDRLKDGCSRQPVLSPHLPRLLSDAWLVASVNCGESQIRSGHLVMALLGDTVLLQLARALSPEWAAW
SAADLLHKWPALVVGSREATARHAPGVHAGASPSPALDQYTVNLTERAHQHQLDPVLGRDGEIRQMIDIL
LRRRQNNPILTGEAGVGKTAVVEGLALRIADGEVPDSLRNVALRMLDLGLLQAGASVKGEFERRLKAVID
EVKACSEPVILFIDEAHTLIGAGGAAGQNDAANLLKPVLARGELRTIAATTWSEYKKYFEKDPALARRFQ
AIKVEEPSEEIAMVMLRGMLSKMRQHHQVRILDEAVTAAVRLSHRYLTGRQLPDKAVSVLDTACARIALG
QRTLPAPVEDACRHLAHLQTEIALLEQEQAGGLDHGSRLMTLQEQARVAQDHYQTLEQRWIEECEQVAII
QALQVQLEQEDCPDRSEMLARREQAVLALEQMQGREPLVQTCVDESAIAAVISAWTGIPLGKMVQDELEM
VRQLQTRLAERVIGQPYALDTIARGIRLSRAGLEDPDKPIGVFLLVGSSGVGKTETALALAETLYGGERN
LITINLSEFQEAHTVSTLRGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDEVEKAHPDVLEVFFQVFDKGV
MDDAEGREINFRNTVILLTSNVGSDTLMAYCQDGMAQPEPEQLCEVLRDDLTQAFKPAFLGRLQVVPYYP
VRGTVLKQIIHLKLDKIARRFQRNHQATLHYDESLVDGIAKRCTQPDSGARLIDNILSAQLLSGMADAVL
AQMAAGEPVSDITIAMDEHGRLTGSLEGSEGWN
 
Nucleotide Sequence: 2622 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2639125-2641746 Edwardsiella ictaluri 93-146 chromosome, complete genome
GTGAATACAGATTTGAAAGCCTTGACGGGGAAAATGAACCAGACCTGCCATCAAGCACTGGAGGCTGCAG
CAGGCCTGTGTCTGTCACGAGGCCATCACGAGGTCGAGATCGAACACGTGCTGCTCAAGTTGCTGGAGAC
GGGCAACACGGATCTGGATCACCTGCTGCAGCACTATGGGATCGACGCCGGCCGTTTTCAGCGGGACGTG
GAGCAGGCGCTGGATCGCCTGAAGGACGGATGCAGCCGACAGCCGGTACTCTCCCCCCATCTGCCACGAC
TGTTGTCTGATGCCTGGCTGGTGGCCTCCGTCAACTGTGGCGAGAGCCAGATCCGCAGCGGTCATCTGGT
CATGGCCCTACTGGGTGACACGGTGCTGCTGCAGCTCGCCAGGGCGCTGTCGCCAGAGTGGGCTGCGTGG
TCTGCGGCAGATCTGCTGCACAAGTGGCCCGCGCTGGTCGTCGGCAGCCGGGAGGCGACGGCGCGGCACG
CGCCGGGAGTTCATGCGGGCGCCTCCCCCTCACCCGCTCTGGATCAATACACGGTAAACCTGACCGAGCG
GGCCCACCAGCATCAGCTGGACCCGGTTCTCGGGCGGGATGGCGAGATTCGGCAGATGATCGATATTTTG
CTGCGCCGCAGGCAGAACAACCCAATTCTTACCGGTGAGGCCGGCGTAGGGAAAACCGCCGTAGTGGAAG
GGCTGGCCCTGCGCATTGCGGACGGAGAGGTTCCGGATAGCCTGCGCAATGTTGCCCTACGGATGCTGGA
TCTGGGCCTGCTCCAGGCGGGTGCCAGTGTCAAAGGGGAGTTTGAACGTCGTCTCAAAGCGGTCATCGAC
GAGGTGAAGGCCTGCAGTGAACCGGTCATTTTGTTCATCGATGAAGCCCATACGCTGATCGGGGCAGGAG
GTGCAGCAGGTCAGAATGATGCCGCCAATCTGCTGAAGCCGGTACTGGCCCGGGGAGAGCTGCGCACCAT
TGCCGCCACCACCTGGAGTGAATACAAAAAGTATTTCGAGAAAGATCCTGCTCTGGCGCGGCGCTTCCAG
GCCATCAAAGTGGAGGAGCCCAGCGAGGAGATCGCCATGGTGATGCTGCGTGGCATGCTGAGTAAAATGC
GCCAGCACCACCAGGTACGGATTCTGGATGAGGCGGTAACGGCCGCCGTCAGGCTGTCACACCGTTATTT
GACCGGCAGACAGCTGCCGGATAAAGCGGTCAGCGTACTGGATACCGCCTGCGCCCGGATTGCGCTCGGG
CAGCGTACCCTGCCAGCCCCCGTCGAGGATGCATGCCGCCATCTGGCGCACCTCCAGACCGAAATTGCGC
TGCTGGAGCAGGAGCAGGCCGGTGGCCTCGACCATGGTAGCCGGCTAATGACACTACAGGAGCAGGCCCG
GGTCGCCCAAGACCATTATCAGACTCTGGAGCAGCGCTGGATCGAGGAGTGTGAGCAGGTCGCCATCATC
CAGGCGCTGCAGGTGCAGTTGGAGCAGGAGGATTGTCCGGACCGCAGTGAGATGCTGGCCCGACGGGAGC
AGGCCGTTCTGGCGCTCGAGCAGATGCAGGGCCGGGAGCCGCTGGTGCAGACCTGTGTGGATGAGTCCGC
CATTGCGGCGGTGATCTCGGCATGGACGGGGATCCCGCTGGGTAAAATGGTGCAGGATGAGCTGGAGATG
GTCCGCCAGCTACAGACACGGCTGGCAGAACGGGTCATCGGACAGCCCTATGCCCTGGATACCATCGCCC
GGGGTATTCGCCTGTCCCGTGCGGGACTGGAGGATCCGGACAAGCCCATCGGCGTCTTTCTGCTGGTCGG
CTCCAGCGGCGTGGGAAAAACCGAGACCGCGCTGGCGCTGGCCGAAACCCTGTATGGCGGTGAGCGTAAC
CTGATCACCATCAACCTGTCGGAGTTTCAGGAGGCCCATACCGTTTCGACGCTGCGGGGCTCACCGCCGG
GCTATGTCGGCTATGGTGAAGGCGGTGTGCTGACAGAGGCAGTACGCCGTAAGCCCTACAGCGTGGTCTT
GCTGGATGAAGTAGAGAAAGCCCACCCGGATGTACTGGAGGTATTTTTTCAGGTGTTTGACAAAGGGGTC
ATGGATGATGCCGAGGGGCGGGAGATCAACTTCCGCAATACCGTTATCCTGCTGACCTCCAACGTCGGCA
GCGATACCCTGATGGCCTACTGTCAGGACGGTATGGCACAGCCCGAACCGGAGCAGCTGTGTGAGGTGCT
GCGGGATGACCTGACCCAGGCCTTCAAGCCTGCCTTTCTCGGACGCCTGCAGGTGGTACCCTACTACCCG
GTACGGGGTACGGTGCTGAAACAGATTATCCACCTCAAGCTGGATAAGATTGCCCGACGCTTTCAGCGCA
ATCATCAGGCCACTCTCCATTACGATGAGTCCCTGGTGGATGGCATTGCCAAACGCTGTACCCAGCCGGA
CAGCGGCGCCCGCCTGATCGATAATATTCTGTCGGCCCAGCTGTTATCCGGTATGGCGGACGCGGTGCTG
GCACAGATGGCCGCCGGCGAGCCGGTATCCGATATCACCATCGCGATGGATGAGCACGGCCGACTGACAG
GATCGCTAGAGGGGAGTGAAGGATGGAATTAA