SecReT6
Protein ID: 238920635
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2747
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2644133..2645203 [+]
Producthypothetical protein
NoteTssA
UniProt IDC5BAE5
KEGG IDeic:NT01EI_2747
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.90E-25, Aligned region: 56..116
ImpA-rel_N [PF06812], Evalue: 4.90E-25, Aligned region: 238..253
Protein Sequence: 356 a.a.     [Download]
>gi|238920635|ref|YP_002934150.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MNILDMARLLAPISEHHPAGEDISFDPLYDQIREARRADADYLGQGEWVSSLKQSNWAEVIRLASEALET
RSKDLQLAVWLCEALVQRHGLPGLQEGLLLLDNLLEHYWAEMYPELTEGELEGRVSRLEWLNQVLPPVLG
LLPLTAAQDRRAYGWLDWQASREVDNLKRLNNEAAQTALGEGKTDPDAWDLAVSHTPGTFYLTLQSDLQQ
AISAFQGLSQRLDPLFGRDVPRISNVAERLEQMLRLVTRLVEGKGMTVTNGTGENPLTPAGTEAIPVVTT
SSPGVAGAPRTREEAIQQLNGIATFFRETEPHSPVSYIVDKAVRWGNMRLDEWIREVVDDNGTRRMLKGV
LGYDEE
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2644133-2645203 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAATATCTTGGATATGGCGCGTTTACTGGCTCCCATCAGTGAGCACCATCCGGCGGGAGAGGATATCA
GCTTCGACCCACTATACGACCAGATTCGGGAAGCCCGCCGGGCCGACGCTGACTACCTGGGACAGGGAGA
GTGGGTCAGCTCACTCAAACAGTCAAACTGGGCCGAGGTGATCCGCCTGGCCAGCGAGGCGCTGGAGACA
CGCAGCAAAGATCTGCAGCTGGCAGTGTGGCTGTGCGAGGCTCTGGTGCAACGGCATGGATTGCCAGGAC
TGCAGGAAGGGCTGCTCTTACTGGATAACCTGCTGGAGCACTATTGGGCGGAAATGTATCCGGAGCTGAC
TGAGGGGGAGCTGGAAGGCCGGGTGAGCCGTCTGGAGTGGCTCAACCAGGTCTTACCCCCGGTGCTGGGC
TTACTCCCCCTGACGGCAGCACAGGACAGACGGGCATATGGCTGGCTGGACTGGCAGGCCTCCCGGGAGG
TCGATAACCTGAAGCGGCTGAACAATGAAGCGGCTCAGACAGCCTTAGGCGAAGGAAAAACGGATCCGGA
CGCGTGGGATCTCGCTGTCAGTCATACGCCAGGCACCTTTTATCTGACGTTACAGAGCGATCTTCAACAA
GCCATCAGTGCATTCCAGGGATTATCCCAGCGGCTCGATCCGCTATTTGGACGGGATGTCCCGCGGATAA
GCAATGTGGCTGAGCGGCTGGAGCAGATGCTCCGGCTGGTGACGCGTCTGGTGGAGGGAAAAGGGATGAC
GGTTACCAACGGCACCGGGGAGAACCCGCTGACACCGGCAGGCACGGAGGCGATCCCCGTGGTCACTACA
TCCTCCCCCGGCGTGGCCGGCGCACCCAGAACCCGCGAGGAGGCCATTCAGCAACTCAACGGTATTGCCA
CGTTTTTCAGGGAGACAGAGCCGCACAGCCCCGTCTCCTACATTGTGGATAAAGCTGTCCGCTGGGGCAA
TATGAGACTGGATGAATGGATCCGGGAGGTCGTGGATGACAACGGTACCCGGCGGATGCTCAAGGGTGTA
TTGGGTTATGATGAAGAATAA