SecReT6
Protein ID: 238920636
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2748
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2645190..2645819 [+]
Producthypothetical protein
NoteTssJ
UniProt IDC5BAE6
KEGG IDeic:NT01EI_2748
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.00E-20, Aligned region: 16..177
Protein Sequence: 209 a.a.     [Download]
>gi|238920636|ref|YP_002934151.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MMKNKTIWGVIGCLLLSLTGCSSDPAKQQARRNTQWLYGSQAVLVNVQTAPDLNSYDGESHSLVLAVVQA
RSPDAFYQLIQTSELVGQVLQGGRPPDGILQVSRYALEPGHDFRLVLDRLQEAHQVGLIAAFYGLPVAQT
SRLFDIPVKVTRSGILFPDWKAAPSPMALNLKLGNSGISEAVMNPVDSIPSASAPTASTPIRLSDISGQ
 
Nucleotide Sequence: 630 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2645190-2645819 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGATGAAGAATAAGACGATCTGGGGAGTCATCGGCTGCCTGCTGCTCAGTCTGACCGGCTGCTCATCCG
ATCCGGCAAAGCAGCAGGCACGCCGCAATACGCAGTGGCTGTATGGCAGCCAGGCCGTTTTGGTTAATGT
ACAAACGGCCCCGGACCTGAACAGCTACGACGGCGAGTCGCACAGCCTGGTACTAGCGGTGGTTCAGGCC
CGTTCACCTGACGCCTTTTATCAGTTAATCCAAACATCCGAACTCGTCGGCCAGGTCTTGCAGGGCGGAC
GTCCCCCTGACGGAATTTTGCAGGTAAGCCGCTATGCGCTGGAGCCCGGCCACGATTTCCGCCTGGTCCT
GGATCGCCTGCAGGAGGCACACCAGGTGGGGCTCATCGCCGCTTTCTACGGTCTACCGGTGGCGCAGACC
TCCCGCCTGTTTGATATCCCGGTAAAAGTGACCCGCTCGGGGATACTGTTCCCGGACTGGAAAGCCGCCC
CCTCCCCTATGGCGTTGAACCTGAAACTGGGTAACAGCGGGATAAGCGAGGCGGTAATGAATCCGGTGGA
TAGCATCCCCTCGGCCAGCGCACCGACAGCATCGACGCCAATCCGGCTGAGCGATATCAGTGGACAATAG