SecReT6
Protein ID: 238920637
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2749
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2645916..2647304 [+]
Producthypothetical protein
NoteTssK
UniProt IDC5BAE7
KEGG IDeic:NT01EI_2749
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.40E-89, Aligned region: 19..460
Protein Sequence: 462 a.a.     [Download]
>gi|238920637|ref|YP_002934152.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MKIHKPIYWHQGMFLQPQHFQLADLHTQFQIKPFLNSGLQDFWGVGALTISESALGNQLLNILSAELIFQ
DQSYVIWPGNTILKPRSFASAWLDQSRPFNVYLGLKKQDTIESNVAVVPQLEDGADRNVRCVTTQQGNKH
ADLYSDGPEAEIQSLHYVLQVLWENEVEQLTDYNILPIARLERKGELIQQSRHFIPPCYIMGGSEPLMRV
VRDVRDDLAGRARQLEAYKSPREIRKAEFDASFLMFLLALRTLNRYVPLLYQLTESPLVHPRKVYDVLRQ
IVGELSTFSENCDMLGSTDENSPGLPPYRHQDLAPGLLTVRDLIIRLLNEISIGPDFLITLEPSGEYLTA
QLPNSLLEERNRFYLIVRSDMAPDTLQDSFRARARLAEASAMPLLIQRALPGITLTPLSSVPEGLPRRSC
SFYFKIDSQSEAWRQAAQSCHIAFSWFDAPDDVKVELVGVNR
 
Nucleotide Sequence: 1389 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2645916-2647304 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAAAATTCACAAACCAATTTATTGGCATCAGGGCATGTTTTTACAGCCGCAGCATTTTCAGCTGGCAG
ACCTGCATACTCAGTTTCAGATCAAGCCATTCCTGAATTCCGGACTGCAAGATTTTTGGGGAGTGGGAGC
GCTGACCATTTCAGAGTCAGCCCTGGGTAACCAGCTGCTTAATATCCTGTCGGCTGAGCTGATCTTCCAG
GATCAAAGCTATGTCATATGGCCGGGTAACACCATCCTTAAGCCACGATCCTTCGCCTCTGCCTGGCTGG
ATCAGAGCCGACCGTTCAATGTCTACCTGGGGCTAAAAAAGCAGGACACAATAGAGTCCAATGTGGCCGT
CGTGCCACAGCTTGAGGATGGCGCAGACCGGAATGTCCGTTGCGTGACGACCCAACAGGGAAACAAGCAC
GCTGATTTATATTCGGATGGGCCCGAAGCCGAGATCCAGAGCCTGCACTACGTACTGCAGGTGCTGTGGG
AAAATGAGGTTGAACAGCTGACGGATTACAATATCCTGCCAATCGCCCGGTTGGAGCGTAAGGGAGAGCT
GATTCAGCAGTCCAGACACTTCATTCCGCCGTGTTACATCATGGGTGGCTCCGAGCCCCTGATGCGGGTG
GTACGGGATGTACGGGACGATCTGGCAGGACGCGCCCGCCAGCTGGAGGCCTATAAAAGTCCGCGCGAAA
TCCGCAAGGCGGAGTTTGATGCCAGCTTTCTGATGTTTCTGCTGGCCCTGCGCACCCTCAACCGCTATGT
ACCGCTGCTGTATCAGCTGACCGAATCACCGTTGGTCCATCCGCGCAAAGTCTACGACGTACTGCGGCAG
ATCGTCGGCGAGCTGTCCACCTTCAGCGAGAACTGCGACATGCTGGGATCCACGGATGAAAACAGCCCGG
GGCTCCCACCCTACCGCCATCAGGATCTCGCTCCGGGTCTCTTAACGGTACGCGATCTGATTATTCGGCT
ATTGAATGAAATATCGATCGGACCTGATTTCCTGATCACCCTTGAGCCAAGCGGAGAGTATCTGACGGCA
CAGCTACCCAATAGTCTGCTGGAGGAGCGTAACCGTTTCTACCTGATCGTCCGCAGCGACATGGCACCGG
ATACCCTGCAGGACTCGTTCCGGGCCAGGGCCAGACTGGCCGAGGCCAGCGCAATGCCCTTACTGATCCA
GCGAGCCTTACCGGGGATCACGCTGACGCCGCTATCGTCAGTTCCCGAGGGCTTGCCCCGGCGATCCTGC
TCATTTTATTTCAAGATCGACTCCCAGAGTGAAGCCTGGCGGCAGGCCGCCCAGAGTTGCCATATTGCAT
TCAGCTGGTTCGATGCCCCAGATGACGTCAAAGTAGAATTGGTAGGAGTGAACCGGTGA