SecReT6
Protein ID: 238920638
SecReT6 ID346
T6SS typei4b
Gene symbol-
Locus tagNT01EI_2750
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T6SS(s) in this replicon]
Location [Strand]2647469..2647951 [+]
Producthypothetical protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.20E-33, Aligned region: 2..148
Protein Sequence: 160 a.a.     [Download]
>gi|238920638|ref|YP_002934153.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MYAVVAWIDETIMCSDWDGVATWRREPLQASYFNTVCAGVDFFDRLSALSPEADDVREVYLLCLALGFEG
RHTGSMGQATLEQIRMHQLKTLHGEIWEESQRLFPEAYPIPSVKPPQQKRLLTNSRFTTIVVPLVILVAL
YGILNWVLYEYADVALELLP
 
Nucleotide Sequence: 483 bp     [Download]
>gi|238917983|ref|NC_012779.1|:2647469-2647951 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGTATGCCGTGGTGGCCTGGATAGATGAGACGATCATGTGTTCGGACTGGGACGGCGTTGCAACATGGC
GCCGTGAGCCACTGCAGGCCAGTTACTTCAACACCGTCTGCGCCGGAGTTGACTTTTTCGACAGGCTGTC
CGCACTGAGCCCCGAAGCCGACGACGTCAGAGAAGTCTATCTGCTGTGTCTGGCTCTGGGATTTGAGGGG
CGCCATACCGGCAGCATGGGTCAGGCCACGCTGGAACAGATCAGGATGCACCAACTGAAGACCCTGCACG
GCGAGATATGGGAGGAGTCACAGCGTCTATTTCCGGAGGCCTATCCGATACCCTCAGTCAAACCGCCGCA
GCAAAAGCGATTGCTGACCAACAGCCGTTTTACCACCATCGTGGTGCCGCTGGTCATATTGGTCGCACTG
TATGGAATTCTGAACTGGGTATTATATGAGTATGCGGATGTCGCGCTGGAGTTGCTGCCATGA