SecReT6
Protein ID: 239509131
SecReT6 ID802
T6SS typeN/A
Gene symbolclpV
Locus tagclpV
StrainVibrio anguillarum NB10
Repliconchromosome [GenBank: GQ118992] [Browse all T6SS(s) in this replicon]
Location [Strand]1..591 [+]
ProductClpV
NoteTssH
UniProt IDC5MK38
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.80E-22, Aligned region: 7..95
AAA_2 [PF07724], Evalue: 6.80E-22, Aligned region: 143..167
ClpB_D2-small [PF10431], Evalue: 8.30E-14, Aligned region: 101..175
AAA_5 [PF07728], Evalue: 0.0028, Aligned region: 7..56
AAA_5 [PF07728], Evalue: 0.0028, Aligned region: 134..151
Protein Sequence: 196 a.a.     [Download]
>gi|239509131|ref|ACR81554.1| ClpV [Vibrio anguillarum]
RKNPYSVLLLDEMEKAHPSVHDIFYQIFDKGSISDSEGRHIDFRNTIIIMTSNAADSAVVNACENSRPDV
PTLTQSIFPELQKHFKPAFLGRATIVPYFPLNDEEMAQIATLSLNRIRKRVQSHYKASFEFHPDVIDLLV
NMNDSPETGARAVEQLINRQLMPDLANQCIVRMSENKPVEVVTVHVEEGKFKIQIQ
 
Nucleotide Sequence: 591 bp     [Download]
>gi|239509130|gb|GQ118992|clpV|:1-591
CGTAAGAACCCATATTCTGTACTGCTGCTGGATGAAATGGAAAAAGCCCACCCTAGTGTGCACGATATCT
TCTATCAAATCTTTGATAAAGGCTCGATCTCGGACAGTGAAGGTCGACACATCGATTTTCGTAATACGAT
CATCATCATGACATCAAACGCGGCAGACAGCGCTGTTGTTAATGCATGTGAAAATAGTCGACCGGATGTT
CCGACGCTGACTCAGTCTATTTTCCCTGAGCTGCAAAAACACTTTAAACCAGCATTTCTTGGCCGTGCGA
CCATCGTGCCTTACTTCCCTTTGAACGATGAAGAAATGGCGCAAATTGCAACCTTGTCTCTGAACCGCAT
TCGCAAGCGCGTTCAATCCCACTACAAAGCAAGTTTCGAATTTCACCCTGATGTGATTGATCTGCTGGTC
AATATGAATGATTCACCAGAAACAGGAGCTCGTGCCGTTGAGCAACTGATCAATCGTCAACTTATGCCGG
ATTTAGCGAATCAGTGCATTGTCCGCATGAGCGAGAACAAGCCAGTAGAAGTGGTCACTGTTCACGTTGA
AGAAGGCAAATTTAAGATTCAGATTCAATAG