SecReT6
Protein ID: 239509136
SecReT6 ID802
T6SS typeN/A
Gene symbolvtsE
Locus tagvtsE
StrainVibrio anguillarum NB10
Repliconchromosome [GenBank: GQ118992] [Browse all T6SS(s) in this replicon]
Location [Strand]5955..6902 [+]
ProductVtsE
NoteFha
UniProt IDC5MK43
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-12, Aligned region: 30..97
Protein Sequence: 315 a.a.     [Download]
>gi|239509136|ref|ACR81559.1| VtsE [Vibrio anguillarum]
MPLSIRIISSPDGESIAQWNQAFPDDGGDIGRAFGATLQLNDASREISSTHAMIRKTSRGYQIMDNSTNG
LYINGSDVPLGKGNQSTLSDGDVLDIGRYRLLVSCFFPETAKAQIQQPHSDSCRLGDDPFSTESTPFIQS
IPEVDEAPGFTISTTDVVGDDPFASDASVKQELAPHFNLDFQTAEDDPLKDSDFRTSFPNHEVMATSSFA
QEESPLNHSQFAITEFKNHGQRLQERTDKALEMALARLLSDISPNAMESMFDDLSGNGFWSRKPKYWDMY
KRYFNRQVENRDWQIKFQAYFRDAMRMQKNFEGDQ
 
Nucleotide Sequence: 948 bp     [Download]
>gi|239509130|gb|GQ118992|vtsE|:5955-6902
ATGCCTCTATCGATTAGAATTATTAGCTCTCCAGATGGTGAAAGCATCGCCCAATGGAATCAAGCATTTC
CAGACGATGGCGGAGATATCGGGCGTGCGTTTGGCGCGACGCTACAACTTAATGACGCAAGTCGTGAGAT
TTCAAGTACCCATGCAATGATTCGTAAGACCTCGCGTGGATACCAAATCATGGACAACAGCACCAATGGC
CTTTACATCAATGGATCTGATGTGCCTTTGGGCAAGGGTAACCAATCTACACTAAGTGATGGTGATGTTC
TTGATATTGGCCGCTACCGATTGCTGGTTTCTTGTTTCTTCCCTGAAACAGCGAAAGCGCAAATCCAGCA
GCCTCACTCAGATAGTTGTCGATTAGGTGATGATCCGTTTAGTACTGAATCAACACCTTTTATTCAAAGT
ATTCCTGAAGTAGATGAAGCGCCTGGGTTCACCATCTCGACGACAGATGTGGTGGGGGATGACCCATTTG
CGAGTGATGCCTCAGTTAAGCAAGAACTAGCGCCTCACTTTAATCTTGATTTTCAGACGGCTGAGGATGA
CCCACTGAAAGACAGTGATTTTCGTACGTCATTTCCAAACCATGAAGTGATGGCGACCTCCTCTTTCGCT
CAAGAAGAGTCACCACTGAACCACTCTCAGTTTGCTATCACTGAGTTTAAGAATCATGGGCAGCGCTTAC
AGGAACGTACGGACAAAGCATTAGAGATGGCATTGGCAAGGTTGTTGTCTGACATTTCACCGAATGCGAT
GGAGTCGATGTTTGATGATTTGTCGGGCAACGGTTTTTGGTCTCGTAAACCGAAGTACTGGGATATGTAC
AAACGCTATTTCAACCGACAAGTAGAGAATCGCGATTGGCAAATTAAGTTTCAAGCGTACTTCAGAGATG
CAATGCGTATGCAAAAAAACTTCGAAGGGGATCAGTAA