SecReT6
Protein ID: 239509137
SecReT6 ID802
T6SS typeN/A
Gene symbolvtsF
Locus tagvtsF
StrainVibrio anguillarum NB10
Repliconchromosome [GenBank: GQ118992] [Browse all T6SS(s) in this replicon]
Location [Strand]6902..7369 [+]
ProductVtsF
NoteTssJ
UniProt IDC5MK44
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.10E-32, Aligned region: 12..144
Protein Sequence: 155 a.a.     [Download]
>gi|239509137|ref|ACR81560.1| VtsF [Vibrio anguillarum]
MVRRLCLMCIVLIMSGCSLWSYDMVEPKLVVDIKAATNINPNVEGKPSPVELRIYQLTNNNAFEISDFIQ
VYNDDQGVLKAELAVSRQLPSILPGETRQEIIPLGSGVKYIGVIAGFADYREAKNKVIYKPLIVNSAVIS
IEIDGINLSVSGEEE
 
Nucleotide Sequence: 468 bp     [Download]
>gi|239509130|gb|GQ118992|vtsF|:6902-7369
ATGGTACGTCGTTTATGCCTAATGTGTATCGTCCTTATTATGTCAGGGTGCAGTTTATGGAGCTATGATA
TGGTTGAGCCAAAACTGGTCGTTGATATTAAAGCTGCGACCAATATTAACCCTAATGTTGAGGGTAAGCC
TTCTCCGGTAGAGCTCCGAATTTATCAATTGACGAATAATAATGCGTTTGAAATTTCTGATTTTATTCAA
GTTTATAATGATGACCAAGGCGTTTTAAAGGCCGAGTTGGCCGTTTCTCGCCAGCTACCCAGCATTTTGC
CGGGCGAAACTCGTCAGGAAATTATCCCACTTGGTAGTGGTGTTAAGTACATCGGTGTGATTGCGGGTTT
TGCTGATTACAGAGAGGCGAAAAACAAGGTGATTTATAAGCCGCTAATTGTGAATTCAGCGGTTATCAGT
ATTGAAATTGATGGCATTAATCTGTCTGTGTCAGGGGAAGAAGAATAA