SecReT6
Protein ID: 239509138
SecReT6 ID802
T6SS typeN/A
Gene symbolvtsG
Locus tagvtsG
StrainVibrio anguillarum NB10
Repliconchromosome [GenBank: GQ118992] [Browse all T6SS(s) in this replicon]
Location [Strand]7369..8685 [+]
ProductVtsG
NoteTssK
UniProt IDC5MK45
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.50E-114, Aligned region: 18..438
Protein Sequence: 438 a.a.     [Download]
>gi|239509138|ref|ACR81561.1| VtsG [Vibrio anguillarum]
MDNNKVVWSEGMFLSPQHFQQQERYVEHFTREFAGQISPNAYGFTSLELDRSMLNIGKVSVRRAKGIFPD
GTPFEIEQALVLDVPKNTSHKKVYLALPVSRPGTIDVGEDARLRHSSQEHPVYDTSREHSDPVQLELATL
NIQLRLEGDELKDFVLISVAEISEHKSEGVVVLNQAFVPQCLQFSVSNYLTDNVADLFAQVQYRSRAIHT
RLQAESSSKSYQSLMRDYLWLQVLGAWMPKLEQWSLDGSLLTRHLYLECVSMAGQMQGLEGKMPKSFPAW
NQDALYSIFSTVFSELLVLLREVQIDNVSTLNWDKQLFVSRRLLRTLVDDRSLYNQGRFVLAVSSSIGAT
RLSEEFPRAAKLAGNSDIAGLVRNALSGVPLRHLPYAPSELKSLNDAAYFEIDTKSELWQALIKRDEAIA
LHIDERIDDLHVDFHVIR
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|239509130|gb|GQ118992|vtsG|:7369-8685
ATGGATAATAATAAAGTCGTGTGGAGTGAGGGGATGTTCCTTTCCCCTCAGCACTTTCAACAGCAAGAGC
GCTATGTTGAACATTTTACTCGTGAGTTCGCCGGACAAATTAGCCCTAATGCTTATGGATTCACCTCGCT
AGAGCTTGACCGTTCGATGTTGAACATTGGTAAGGTTTCGGTGCGTCGCGCTAAAGGCATTTTCCCAGAT
GGAACACCATTTGAAATTGAGCAAGCACTCGTGCTCGATGTGCCGAAAAATACCAGTCATAAGAAAGTGT
ATCTGGCTCTTCCGGTTTCAAGACCGGGCACTATTGATGTGGGAGAAGACGCGCGTCTTAGACACTCTTC
ACAAGAACACCCCGTTTACGATACCAGCCGAGAGCACAGTGACCCGGTTCAATTAGAGCTAGCAACGTTG
AACATTCAGCTGCGTTTGGAAGGGGATGAGCTAAAAGATTTTGTGTTGATATCCGTTGCTGAAATCAGTG
AACACAAATCTGAAGGTGTTGTTGTGTTGAACCAAGCATTCGTTCCCCAATGCTTGCAGTTTTCCGTATC
TAACTACCTAACCGATAACGTTGCTGATCTATTTGCACAAGTACAATACCGTTCCCGAGCGATTCATACT
CGTTTACAAGCGGAGTCCAGCAGTAAAAGCTATCAGTCGTTGATGCGTGACTACTTGTGGCTGCAAGTAC
TGGGGGCTTGGATGCCAAAGCTTGAACAATGGAGTCTAGATGGCTCGTTGCTGACACGTCATCTTTATTT
AGAGTGTGTTTCGATGGCTGGGCAGATGCAGGGTTTAGAAGGGAAGATGCCAAAGTCTTTCCCTGCATGG
AACCAAGATGCGCTATACAGCATTTTTTCGACCGTGTTTTCTGAGTTACTGGTGTTACTGCGTGAGGTTC
AGATAGATAACGTATCAACATTGAACTGGGACAAACAGCTGTTCGTTAGCCGCCGCTTACTGCGCACACT
GGTTGATGATCGCAGCCTATACAATCAAGGCCGTTTTGTGTTGGCCGTTTCCTCGTCTATCGGTGCCACT
CGACTCAGTGAAGAGTTTCCTCGTGCTGCGAAGCTAGCAGGGAACAGTGATATTGCCGGTTTAGTGCGTA
ATGCACTTTCAGGTGTTCCTTTGCGCCATCTTCCTTATGCACCTTCTGAGTTGAAGTCTTTGAATGACGC
CGCTTACTTCGAAATCGATACTAAGTCTGAATTGTGGCAAGCGTTGATCAAACGTGATGAGGCGATCGCT
CTTCATATTGATGAAAGAATTGATGATCTCCACGTCGATTTTCATGTGATCAGGTAG