SecReT6
Protein ID: 239509139
SecReT6 ID802
T6SS typeN/A
Gene symbolvtsH
Locus tagvtsH
StrainVibrio anguillarum NB10
Repliconchromosome [GenBank: GQ118992] [Browse all T6SS(s) in this replicon]
Location [Strand]8693..9835 [+]
ProductVtsH
NoteTssL
UniProt IDC5MK46
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.00E-52, Aligned region: 50..249
Protein Sequence: 380 a.a.     [Download]
>gi|239509139|ref|ACR81562.1| VtsH [Vibrio anguillarum]
MGGLFNEEPTVQIRRVTSTESAHKQHLLPPKADTSGTERLIEDLAIYGSPLLNAATELLGILVTIKRQGT
PRDINRFRQKLLYAIDAFRLRGLHLDYHPSVIEKSCFVLCAAFDEAVLYTAWGERARWENHSLLSKVFSQ
RDGGEAFFVLLDKASQQPNKLVDFIELQYVLLALGFKGRFRHEDESQLHDITARAYGLIRHYRSESPFPV
PQTPTLIEGKRPWLMISMGKTLGLACLVLASGYGFTEYWYNSRVQPLLAQFSAIDMSDVNLKKNSSDLVY
LSSDADLGRQSESLEEETGMKGKVVTQQWEIILAVFSRASDALRLSTELKQAGYESFTREMEHGVELYLH
AGDDLNTIRKLKNELNVRFGLNATIKRALK
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|239509130|gb|GQ118992|vtsH|:8693-9835
ATGGGCGGATTATTTAACGAAGAACCGACGGTTCAAATTCGACGAGTGACATCGACCGAATCAGCTCACA
AGCAGCATCTGTTGCCACCCAAAGCGGATACTTCAGGCACAGAGCGATTGATTGAGGATCTTGCCATTTA
TGGTAGCCCTTTATTGAATGCCGCCACGGAACTGTTGGGTATTTTAGTGACGATTAAGCGTCAAGGCACA
CCGAGAGACATCAACCGTTTTCGTCAAAAACTTTTGTACGCCATTGATGCGTTTCGTTTGCGTGGTTTGC
ACTTGGATTACCACCCAAGCGTGATTGAAAAAAGCTGCTTTGTGTTGTGCGCGGCATTTGATGAAGCTGT
GCTGTACACCGCTTGGGGAGAGCGTGCTCGTTGGGAAAATCATTCGTTGTTGAGCAAGGTGTTTTCACAG
CGCGATGGCGGAGAGGCCTTTTTTGTGTTGCTAGATAAGGCCAGCCAGCAGCCGAATAAACTTGTTGATT
TTATTGAGCTTCAGTACGTGCTTTTGGCTTTGGGTTTCAAAGGGCGCTTTCGCCATGAAGACGAGAGCCA
ATTGCATGATATTACCGCTCGTGCGTACGGTCTCATTCGCCACTATCGCAGTGAAAGTCCTTTTCCGGTA
CCGCAAACACCAACGCTAATCGAAGGTAAACGCCCGTGGCTAATGATCAGTATGGGCAAAACGTTAGGCT
TGGCTTGTTTGGTTCTGGCATCCGGGTATGGTTTTACTGAATATTGGTACAACAGCCGCGTGCAGCCGTT
GTTGGCACAGTTTAGCGCGATCGATATGTCAGACGTCAACCTGAAGAAAAACAGCAGTGACTTAGTGTAC
TTAAGTTCCGATGCGGATTTGGGGCGACAGAGTGAAAGCCTAGAGGAAGAAACTGGAATGAAAGGAAAAG
TGGTCACTCAGCAATGGGAGATCATTCTCGCGGTATTTTCTCGGGCGAGCGACGCACTTCGTTTATCGAC
AGAACTCAAACAGGCAGGCTATGAGTCTTTTACTCGTGAGATGGAACATGGCGTTGAGCTTTATCTTCAC
GCAGGTGACGACTTAAACACCATTCGTAAGTTGAAAAATGAACTCAATGTTCGCTTTGGTTTGAACGCCA
CGATTAAAAGAGCGCTGAAATAA