SecReT6
Protein ID: 24111647
SecReT6 ID36
T6SS typeN/A
Gene symbolsafA
Locus tagSF0202
StrainShigella flexneri 2a str. 301
Repliconchromosome [GenBank: NC_004337] [Browse all T6SS(s) in this replicon]
Location [Strand]230040..231086 [-]
Productcytoplasmic protein
NoteTssA
UniProt IDQ83SK5
KEGG IDsfx:S0211, sfl:SF0202
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.00E-20, Aligned region: 51..110
ImpA-rel_N [PF06812], Evalue: 3.00E-20, Aligned region: 221..246
Protein Sequence: 348 a.a.     [Download]
>gi|24111647|ref|NP_706157.1| safA gene product [Shigella flexneri 2a str. 301]
MEIFLSDPISAECPCGPDLEYDPEYLLLFTRAAPREEAQYGDFVSTPENINWAELERDAHRLLMRSKDIR
ILVVLLRCRIQQAGARGLSEALTLLETLCSTYPDAIHPQLLATEDITAEDAAVARSNALAALLDHEGVMA
DIRGITLSNNAAMRLQVRDVERSLSALRPADALAPESVRQQLADLEARGTLPLDAFRQAAETTERLQRHA
RETLNDQAPDFSRLTQLLALLPGAVQSTTPEILPQPQAEQPENATIVHTEQMQAEQIALPVHIAEEISPM
TGAEPRQIRDRNDALERLRVIRRWFEHSEPSSPTIPLLRQAERLVGKRVSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|344915202|ref|NC_004337.2|:c231086-230040 Shigella flexneri 2a str. 301 chromosome, complete genome
ATGGAAATATTCCTGTCTGACCCAATTTCGGCGGAATGCCCCTGCGGCCCGGATCTGGAGTACGATCCGG
AATACCTGCTGCTGTTCACCCGCGCCGCACCGCGTGAAGAAGCGCAATATGGCGATTTTGTCAGTACGCC
GGAAAACATTAACTGGGCGGAGCTTGAGCGGGACGCCCATCGTCTGCTGATGCGCAGCAAAGATATCCGC
ATTCTGGTTGTCCTGCTGCGCTGCCGTATCCAGCAGGCCGGTGCCAGGGGACTGTCGGAGGCGCTCACGC
TGCTGGAAACGTTGTGCTCCACGTACCCGGACGCCATCCATCCTCAACTGCTCGCGACTGAAGATATCAC
CGCCGAAGATGCTGCGGTGGCACGCAGTAACGCGCTGGCGGCGTTGCTGGACCACGAAGGTGTAATGGCG
GATATTCGTGGCATTACACTGTCAAATAATGCTGCCATGCGCCTTCAGGTGCGGGATGTGGAGCGTTCGC
TATCTGCATTACGCCCGGCGGATGCGCTGGCACCAGAATCGGTACGCCAGCAACTGGCAGACCTGGAAGC
GCGCGGCACACTGCCGCTGGATGCCTTTCGCCAGGCAGCAGAGACCACTGAGCGGCTGCAACGCCATGCG
CGTGAAACGCTGAATGACCAGGCACCGGACTTCTCCCGTCTGACGCAACTGCTGGCCCTGTTACCGGGAG
CAGTGCAGAGCACCACGCCGGAGATCCTGCCACAACCACAGGCTGAGCAGCCGGAAAACGCCACCATCGT
TCATACTGAACAGATGCAGGCAGAGCAGATTGCGCTACCGGTGCATATCGCGGAGGAAATATCACCGATG
ACCGGCGCAGAACCCCGGCAGATCCGCGACCGAAACGACGCGCTGGAACGCCTGCGTGTCATCCGTCGCT
GGTTTGAGCACAGCGAACCGAGCAGCCCGACCATTCCTTTGCTGCGCCAGGCAGAACGCCTGGTCGGAAA
ACGCGTCTCGGAGGTAATAAATGAAATTCCAGTAGAACTGCTGGAGAAATGGGATGCGCTGGAGTAA