SecReT6
Protein ID: 24111648
SecReT6 ID36
T6SS typeN/A
Gene symbolsafB
Locus tagSF0203
StrainShigella flexneri 2a str. 301
Repliconchromosome [GenBank: NC_004337] [Browse all T6SS(s) in this replicon]
Location [Strand]231354..231659 [-]
Productperiplasmic chaperone of fimbral assembly machinery
NoteTssG
UniProt IDQ83MB9
KEGG IDsfx:S0213, sfl:SF0203
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.50E-20, Aligned region: 10..99
Protein Sequence: 101 a.a.     [Download]
>gi|24111648|ref|NP_706158.1| safB gene product [Shigella flexneri 2a str. 301]
MSNDFTQAQAPPWRYGFLNLMRRVDVQLCTVPAGNTWQPRMEKFRLGQTPALTFAPREIASVGWQEGRLH
ISLYSLVLWGPNGPLPLHYTELARNRTESRR
 
Nucleotide Sequence: 306 bp     [Download]
>gi|344915202|ref|NC_004337.2|:c231659-231354 Shigella flexneri 2a str. 301 chromosome, complete genome
ATGAGCAACGATTTCACTCAGGCGCAGGCCCCCCCCTGGCGTTACGGTTTTCTGAACCTGATGCGCCGCG
TGGATGTGCAGTTGTGTACCGTTCCGGCGGGCAACACCTGGCAACCACGGATGGAAAAATTTCGCCTCGG
ACAAACGCCCGCGCTGACCTTTGCGCCACGAGAAATCGCCAGTGTGGGCTGGCAGGAAGGGCGCCTGCAC
ATCAGTCTGTACAGCCTCGTGCTGTGGGGGCCGAACGGTCCACTGCCGCTGCACTACACCGAACTGGCGC
GTAACCGGACTGAAAGCCGACGCTGA