SecReT6
Protein ID: 24111649
SecReT6 ID36
T6SS typeN/A
Gene symbolsafC
Locus tagSF0204
StrainShigella flexneri 2a str. 301
Repliconchromosome [GenBank: NC_004337] [Browse all T6SS(s) in this replicon]
Location [Strand]231656..233539 [-]
Productouter membrane usher protein
NoteTssF
UniProt IDQ83SK4
KEGG IDsfl:SF0204, sfx:S0214
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-211, Aligned region: 5..625
Protein Sequence: 627 a.a.     [Download]
>gi|24111649|ref|NP_706159.1| safC gene product [Shigella flexneri 2a str. 301]
MDPRLLEYYNRELSYLRETGAEFAARHPKVAARLGMQGTDIADPYVERMVEAFSFLTARTQLKIDAEFPR
FTQRLLEVVSPNYVTPTPSMSVAQLHPDTEEGDLAKGFTVPRDTAFFSAIPEGESTACQFRSSQDVTLWP
LAIEEARLTAAPPDMPALHRYLPANIHVAGALRITLRTFGELTFSQLAGLDRLPFYLCGEERTASHLLEL
LHTSAIAPLAGIPGHFDGALDVNLQQPVMYEGLEPDQGLLPLAWNVFHGHNLLHEYFACPERFYFFTPTG
LSAGLQKIDGGVAEIVILLNRLPPDWLIHQTNAAQFSLFCTPVINLFPRVTARIDVTHSTTEQHLVVDRT
HPLDYEVFSVQEVEGLETDTTRKMAFRPLYHTRNNDEGNHGRYFSLRREPRRLSENARRYGTRTPYTGSE
VFLSLVDQYEAPYPENLRHITITAMVTNRDLPCLIARNGRDDLTVDAAIPVAGVGLIRPPRSPQPPMAER
EMAWRLIRQLSFNYLPLADLDHRTGGQALRDLLNLFIPAHDSPQSRQVRSLIGCKTTPVTRRLPGSGLLV
YGRGVSCELTVDEEGFSGISPYLFGLVLEHYIARHVSINTFSQMTLHSMQRGKIMTWPVRAGQRGSV
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|344915202|ref|NC_004337.2|:c233539-231656 Shigella flexneri 2a str. 301 chromosome, complete genome
ATGGATCCACGGCTACTGGAATACTACAACCGCGAACTGAGCTATCTGCGGGAAACGGGAGCCGAATTTG
CCGCCCGTCATCCCAAAGTCGCCGCCCGGCTGGGCATGCAGGGAACGGATATTGCCGATCCGTATGTAGA
GCGAATGGTCGAGGCCTTCAGCTTCCTGACCGCCCGCACGCAGCTAAAAATTGACGCTGAATTCCCCCGT
TTCACCCAGCGCCTGCTGGAAGTGGTCAGCCCCAATTACGTCACACCCACGCCCTCAATGAGCGTGGCGC
AGTTGCATCCCGATACGGAAGAAGGCGATCTGGCGAAAGGATTTACCGTCCCGCGCGACACAGCCTTTTT
CTCCGCCATTCCGGAAGGCGAAAGCACTGCCTGCCAGTTTCGCAGCAGCCAGGATGTAACGCTGTGGCCG
CTCGCCATCGAAGAGGCGCGACTGACCGCCGCGCCACCGGATATGCCTGCCCTGCACCGCTACCTGCCGG
CCAACATTCACGTCGCCGGGGCGCTGCGTATTACCCTGCGCACCTTTGGTGAACTAACGTTCAGTCAGCT
TGCCGGACTGGACAGGCTGCCGTTTTATCTCTGCGGCGAGGAGCGTACGGCCTCACACCTGTTAGAACTT
CTACATACCAGCGCCATCGCGCCCCTGGCTGGCATTCCGGGGCATTTTGACGGCGCGCTGGATGTGAATC
TGCAACAGCCCGTTATGTACGAAGGCCTGGAGCCGGATCAGGGGCTGCTGCCGCTGGCGTGGAACGTGTT
TCACGGTCATAACCTGCTGCATGAATATTTTGCCTGTCCGGAACGCTTCTATTTTTTCACCCCGACAGGC
CTGTCTGCCGGATTACAGAAAATTGACGGTGGCGTGGCGGAGATTGTTATCCTGCTGAACCGCCTGCCGC
CGGACTGGCTGATCCACCAGACAAATGCGGCACAGTTCAGCCTGTTCTGTACCCCGGTTATCAACCTGTT
TCCCCGCGTCACCGCCCGGATCGATGTCACGCACAGCACGACGGAACAGCATCTGGTGGTGGACAGAACC
CATCCGCTGGATTATGAGGTGTTCTCGGTCCAGGAAGTGGAAGGGCTGGAAACCGACACCACACGGAAGA
TGGCCTTTCGCCCGCTCTACCACACCCGCAATAATGATGAAGGCAATCACGGACGTTATTTTTCCCTGCG
CCGGGAGCCCCGCCGCTTATCAGAAAACGCCCGCCGTTACGGCACCCGTACCCCCTATACGGGCTCGGAA
GTGTTCCTGTCGCTGGTTGACCAGTATGAAGCGCCGTACCCGGAAAATCTGCGCCACATCACCATCACGG
CCATGGTCACTAACCGCGATCTGCCCTGTCTTATTGCCCGCAATGGCCGGGACGATCTAACCGTGGATGC
AGCCATCCCGGTGGCGGGCGTAGGGCTTATCCGCCCGCCACGCTCGCCGCAGCCCCCGATGGCTGAACGT
GAGATGGCATGGCGGTTGATCCGCCAGTTATCTTTTAATTATCTGCCGCTGGCCGATCTGGATCACCGTA
CCGGCGGCCAGGCGTTGCGAGATCTGCTGAACCTGTTTATTCCTGCTCATGACAGTCCGCAATCGCGCCA
GGTGCGCAGCCTGATTGGTTGTAAAACGACCCCGGTCACCCGCCGTCTGCCCGGTTCCGGACTACTGGTC
TATGGGCGTGGCGTCAGTTGTGAACTGACGGTGGATGAAGAAGGTTTTTCCGGCATCAGTCCGTATCTGT
TCGGCCTGGTGCTGGAACACTATATCGCCCGCCATGTTTCCATTAATACCTTCTCGCAGATGACGCTGCA
CAGCATGCAGCGCGGCAAAATTATGACCTGGCCTGTCAGGGCGGGACAGCGGGGAAGCGTATGA