SecReT6
Protein ID: 251790375
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2793
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3170635..3172068 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDC6CNU1
KEGG IDdze:Dd1591_2793
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.10E-36, Aligned region: 324..472
ImpA-rel_N [PF06812], Evalue: 2.90E-19, Aligned region: 39..98
Protein Sequence: 477 a.a.     [Download]
>gi|251790375|ref|YP_003005096.1| ImpA domain-containing protein [Dickeya zeae Ech1591]
MQDAQQALKVGRDPRMLPEYEALRAEINKLSHASRPEVDWMRVHDMATAIFEKQGVDLQTAIYFTLARSR
LAGLNGFTEGCEFLANLIVTQWENFWPPVHQERARIEILDWFIARISEVIRQYAISHEHKRLVYRCERAL
QLMSEKLHNSGLSRIPRVENLLHFIEGYTHLFDETEIVIVSDDQTLKKQQDMQIPPMVFFQSDMEPGGMA
SVAAAAQPALPSGSILVGREKGQMKPTVLKIEAHRKPKPGWFWFACGVLTCALPVAAITGWQYWQEQKAE
ALALLQQPAYTLPAAPDHNDIRRVRIVLGEQKLQSMEGELTNRYQAQLEQVKNASSFYLFQYGEGLKGVM
QQLYPDSLAVKEMDRQWQIALDRQQGDKPPRVSGYEQARAGVGDTLQQLLDLEKQRRTVTISYLKSQLYD
IQQDLASDVPFGIRLRTLEARKAARQSLTPAELRGMEDELRAFTIRLYRLQQGDSGS
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3172068-3170635 Dickeya zeae Ech1591 chromosome, complete genome
ATGCAAGATGCACAACAGGCCCTGAAAGTGGGCCGTGATCCACGGATGTTGCCTGAGTACGAGGCGCTGC
GCGCGGAAATCAACAAGCTGAGCCATGCCTCCCGCCCGGAAGTGGACTGGATGCGGGTGCACGATATGGC
GACCGCGATTTTTGAGAAACAGGGCGTCGACCTGCAAACCGCCATCTATTTTACCCTGGCGCGCTCGCGT
TTGGCCGGGTTGAACGGCTTCACCGAAGGCTGCGAGTTCCTCGCTAACCTGATCGTCACCCAGTGGGAAA
ACTTTTGGCCGCCGGTGCATCAGGAGCGGGCGCGTATCGAAATTCTGGACTGGTTTATCGCCCGCATCAG
CGAGGTGATTCGCCAGTACGCCATCAGCCACGAACACAAACGGCTGGTGTATCGCTGCGAACGCGCGTTG
CAACTGATGAGCGAAAAACTGCACAACTCCGGCCTGAGCCGCATTCCCCGGGTGGAGAACCTGCTGCACT
TTATCGAAGGCTACACCCACCTGTTCGATGAAACCGAGATTGTGATTGTCTCTGATGATCAAACGCTGAA
AAAACAGCAGGATATGCAGATCCCGCCGATGGTGTTCTTCCAGTCCGATATGGAACCGGGCGGAATGGCG
TCTGTGGCGGCGGCGGCCCAGCCGGCGCTGCCGTCGGGCAGTATTCTGGTCGGGCGGGAGAAAGGACAGA
TGAAACCTACCGTATTGAAAATTGAAGCGCATCGTAAACCGAAACCGGGCTGGTTCTGGTTTGCCTGCGG
CGTGCTGACCTGCGCGTTGCCGGTGGCGGCCATCACCGGTTGGCAGTACTGGCAGGAGCAGAAAGCCGAG
GCGCTGGCGTTGTTGCAGCAACCGGCATACACGCTGCCGGCGGCACCCGATCACAATGATATCCGCCGGG
TGCGCATTGTGCTGGGCGAGCAGAAGCTGCAAAGCATGGAAGGCGAGCTGACCAACCGTTATCAGGCGCA
ACTGGAACAGGTGAAGAACGCGTCGTCGTTCTATCTGTTTCAGTATGGCGAAGGGCTCAAAGGCGTGATG
CAACAGCTGTATCCCGACTCGCTGGCGGTCAAAGAGATGGATCGGCAGTGGCAGATAGCCCTTGACCGCC
AACAGGGCGACAAGCCGCCGCGTGTCAGCGGTTACGAGCAGGCACGCGCCGGGGTGGGCGATACGCTGCA
ACAACTGCTGGATCTGGAGAAGCAGCGCCGCACGGTGACCATTTCGTACCTGAAATCACAACTTTATGAT
ATTCAGCAAGATCTGGCGTCCGATGTGCCGTTCGGCATTCGCCTGCGGACGCTGGAGGCGCGTAAAGCGG
CCCGCCAGTCGCTGACCCCGGCGGAACTGCGCGGCATGGAAGATGAGCTGCGTGCGTTCACCATCCGGTT
GTATCGGTTGCAGCAAGGCGATAGCGGCAGTTAA