SecReT6
Protein ID: 251790377
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2795
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3175643..3177082 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDC6CNU4
KEGG IDdze:Dd1591_2795
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-15, Aligned region: 49..109
ImpA-rel_N [PF06812], Evalue: 1.10E-15, Aligned region: 168..180
ImpA-rel_N [PF06812], Evalue: 1.10E-15, Aligned region: 358..380
ImpA-rel_N [PF06812], Evalue: 1.10E-15, Aligned region: 401..412
Protein Sequence: 479 a.a.     [Download]
>gi|251790377|ref|YP_003005098.1| type VI secretion-associated protein [Dickeya zeae Ech1591]
MHTHPWCKRLLTTLPDDALRAAVAADDPLWEQVETELVKLGSLAHSQVDLNAVAGQCLTLLESRTKDMRV
LVQLLRCLQHPAKATPFATAIMLLDSWLEAYWTTAFPASPVQKQKLMVQIIRRFEGVLPRMTENASGAEL
HQLHQLAEQLASRWSGLAADKADLTDELVAALQRARQRHQAQEKANQAAEPAPGGQGGTAGNAADGGGNG
STAGTAASAAATVDINSSDDRSWKQTQLTVAALLVERQPEAPVGYRLRRNAVWAGIATPPSTARGNKTQL
APVSPDRVDEYQSALGQADLALWNKIEQSLTLAPYWFDGHMLSATVATRLGHGTVASAIADELSAFLTRL
PELRELAFSDGSPFLSAKCAQWLQSAQPARGGGGQRQDDLAAEAAACCAEQGLSAALSLLDERIRRLKEP
RERFLAELVLADLLAEEGMKALAAQHYQHLWQESERLGLMQWEPGMVSRLERLGASRRK
 
Nucleotide Sequence: 1440 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3177082-3175643 Dickeya zeae Ech1591 chromosome, complete genome
ATGCATACACACCCCTGGTGTAAGCGACTGTTGACGACCTTGCCCGACGATGCGTTGCGGGCGGCGGTGG
CGGCGGATGATCCGCTGTGGGAACAGGTGGAAACCGAACTGGTCAAGCTGGGATCGCTGGCGCACAGCCA
GGTGGATCTCAACGCGGTCGCCGGTCAGTGCCTGACGCTGCTGGAAAGCCGCACCAAAGACATGCGCGTG
CTGGTGCAGTTGCTGCGCTGTCTGCAACACCCGGCGAAGGCGACGCCGTTCGCTACCGCCATCATGCTGC
TCGACAGCTGGCTGGAGGCTTACTGGACGACGGCGTTTCCCGCCAGCCCGGTACAAAAACAGAAACTGAT
GGTGCAGATCATTCGCCGCTTTGAGGGCGTCTTGCCGCGCATGACGGAGAATGCCTCCGGGGCGGAGCTG
CATCAGTTGCATCAACTGGCGGAACAGCTGGCGTCGCGCTGGAGCGGGCTGGCCGCCGACAAAGCGGACC
TGACCGACGAACTGGTGGCGGCGCTTCAGCGTGCCCGGCAACGTCATCAGGCGCAGGAGAAAGCCAATCA
GGCGGCGGAACCCGCGCCTGGCGGGCAGGGCGGAACGGCCGGCAACGCGGCTGACGGCGGCGGCAATGGC
AGCACCGCCGGGACCGCCGCCAGCGCGGCCGCGACGGTGGATATCAACAGTTCGGACGATCGTAGCTGGA
AGCAGACGCAGCTTACCGTGGCGGCGCTACTGGTGGAACGTCAGCCGGAAGCGCCGGTGGGGTATCGTCT
GCGCCGCAACGCGGTTTGGGCGGGGATCGCCACGCCGCCGTCGACGGCGCGCGGTAACAAAACCCAACTG
GCGCCGGTGTCGCCCGACCGGGTGGATGAATACCAGAGCGCGCTTGGACAGGCGGATCTGGCGCTGTGGA
ACAAGATTGAACAGAGCCTGACGCTGGCGCCGTACTGGTTTGACGGCCACATGCTGTCGGCGACGGTAGC
GACCCGGCTGGGGCATGGCACCGTCGCCAGCGCCATCGCCGATGAACTGTCGGCGTTTCTCACCCGGTTG
CCGGAATTACGCGAGCTGGCGTTCAGCGATGGGTCGCCGTTTCTGTCGGCCAAATGCGCCCAGTGGCTGC
AATCCGCCCAGCCGGCGCGCGGCGGCGGCGGCCAACGGCAGGACGACCTGGCGGCTGAGGCGGCGGCGTG
CTGCGCCGAGCAAGGGCTGAGCGCCGCGCTGTCGTTATTGGATGAACGTATTCGACGTTTGAAAGAACCG
CGTGAGCGTTTTTTGGCCGAGCTGGTATTGGCGGATTTACTGGCGGAAGAAGGCATGAAAGCACTGGCGG
CACAGCATTATCAGCACCTGTGGCAGGAAAGCGAGCGATTGGGCCTGATGCAGTGGGAACCGGGAATGGT
CAGCCGACTGGAGCGGCTGGGCGCGTCCCGCAGGAAATAA