SecReT6
Protein ID: 251790380
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2798
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3179198..3181816 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC6CNU7
KEGG IDdze:Dd1591_2798
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-37, Aligned region: 278..326
AAA_2 [PF07724], Evalue: 1.40E-37, Aligned region: 603..770
AAA [PF00004], Evalue: 6.70E-19, Aligned region: 220..332
AAA [PF00004], Evalue: 6.70E-19, Aligned region: 538..579
AAA [PF00004], Evalue: 6.70E-19, Aligned region: 609..730
AAA_5 [PF07728], Evalue: 5.20E-13, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 5.20E-13, Aligned region: 608..726
AAA_16 [PF13191], Evalue: 2.50E-11, Aligned region: 135..158
AAA_16 [PF13191], Evalue: 2.50E-11, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 2.50E-11, Aligned region: 258..298
AAA_16 [PF13191], Evalue: 2.50E-11, Aligned region: 366..484
AAA_16 [PF13191], Evalue: 2.50E-11, Aligned region: 499..530
AAA_16 [PF13191], Evalue: 2.50E-11, Aligned region: 582..647
AAA_16 [PF13191], Evalue: 2.50E-11, Aligned region: 674..702
ClpB_D2-small [PF10431], Evalue: 3.60E-10, Aligned region: 130..156
ClpB_D2-small [PF10431], Evalue: 3.60E-10, Aligned region: 776..849
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 219..310
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 607..626
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 670..702
NACHT [PF05729], Evalue: 2.80E-05, Aligned region: 220..245
NACHT [PF05729], Evalue: 2.80E-05, Aligned region: 413..450
NACHT [PF05729], Evalue: 2.80E-05, Aligned region: 609..633
NACHT [PF05729], Evalue: 2.80E-05, Aligned region: 820..844
DUF258 [PF03193], Evalue: 0.00013, Aligned region: 185..237
DUF258 [PF03193], Evalue: 0.00013, Aligned region: 609..624
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 200..234
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 272..353
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 609..646
Arch_ATPase [PF01637], Evalue: 0.00015, Aligned region: 679..690
AAA_29 [PF13555], Evalue: 0.0003, Aligned region: 215..237
AAA_29 [PF13555], Evalue: 0.0003, Aligned region: 606..630
AAA_25 [PF13481], Evalue: 0.00038, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 0.00038, Aligned region: 273..306
AAA_25 [PF13481], Evalue: 0.00038, Aligned region: 430..480
AAA_25 [PF13481], Evalue: 0.00038, Aligned region: 603..637
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 220..267
AAA_17 [PF13207], Evalue: 0.0015, Aligned region: 609..643
AAA_19 [PF13245], Evalue: 0.0028, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 0.0028, Aligned region: 362..397
AAA_19 [PF13245], Evalue: 0.0028, Aligned region: 531..550
AAA_19 [PF13245], Evalue: 0.0028, Aligned region: 602..626
IstB_IS21 [PF01695], Evalue: 0.0041, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 0.0041, Aligned region: 608..619
Sigma54_activat [PF00158], Evalue: 0.005, Aligned region: 218..234
Sigma54_activat [PF00158], Evalue: 0.005, Aligned region: 608..706
Ras [PF00071], Evalue: 0.0065, Aligned region: 220..233
Ras [PF00071], Evalue: 0.0065, Aligned region: 354..394
Ras [PF00071], Evalue: 0.0065, Aligned region: 609..650
MobB [PF03205], Evalue: 0.0077, Aligned region: 220..241
MobB [PF03205], Evalue: 0.0077, Aligned region: 608..629
Zeta_toxin [PF06414], Evalue: 0.0093, Aligned region: 217..237
Zeta_toxin [PF06414], Evalue: 0.0093, Aligned region: 465..509
Zeta_toxin [PF06414], Evalue: 0.0093, Aligned region: 607..648
Protein Sequence: 872 a.a.     [Download]
>gi|251790380|ref|YP_003005101.1| type VI secretion ATPase, ClpV1 family [Dickeya zeae Ech1591]
MIRIELPILVERLNPLCRHMMEEAAALCIQHQGAEIRIEHLLLKMLETPLCDVRLILKRAGVEADELAAL
LQPNAADKGFESGYPSFSPLLVEWLQDSWLLASAELQHARLRSGVLLLVLLMTPTRYLSATVTRQLAQIN
RELLRQQFDEWVKDSAETEVVTATGVAPEQAAAATTQLSRYTQNVTESARQGKLDPVLCRDHEIDLMIDI
LSRRRKNNPIVVGEAGVGKSALIEGLALRIVAGLVPERLRDVELLTLDLGAMQAGASVKGEFEKRFKGVM
QEVKEAPKPIVLFIDEAHTLIGAGNQAGGLDVSNLLKPALARGELRTIAATTWSEYKKYVEKDAALSRRF
QLVKVGEPNVEQATVILRGLRSIYEQSHGVLIDEEALQAAANLSARYISGRQLPDKAIDVLDTACARVAI
NLTTPPRAVSQLQTRLHQQALEIAQLERQGRIGLGDTEERLVTLREARETDAATLAQLEADWQRQKTLVQ
QIVALRTALLADEPAADFDAAAAAAELADSERALAELQQPSVLVSPHVDKTQIASVIAEWTGVPLNRISQ
GELDVVTRLPDYLGDSIKGQQLAIAQLHKHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVVQIADLMF
GGRHYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQA
FDKGELADGEGRLIDCRNVVFFLTSNLGFQTIVNFVERVNFADRQDELLDALYPELAAFFKPALLARMEV
IPYLPLDYDTLVEIVQGKLSRLVTLLQQRFGAEVVIDATVPEEILRLANRSENGARMLESVIDGALLPPV
SLQLLQRLSAGQPVSRIHFQVEDGQFRSEVEG
 
Nucleotide Sequence: 2619 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3181816-3179198 Dickeya zeae Ech1591 chromosome, complete genome
GTGATTCGAATCGAACTGCCGATCCTGGTTGAGCGACTCAACCCGCTGTGCCGCCACATGATGGAAGAAG
CGGCGGCGCTGTGTATTCAGCATCAGGGCGCGGAGATCCGCATTGAGCACCTGTTGCTGAAAATGCTGGA
AACGCCGTTGTGCGACGTGCGCCTGATCCTCAAACGCGCCGGGGTAGAGGCCGACGAACTGGCGGCCCTG
TTGCAGCCCAATGCCGCAGACAAAGGGTTTGAGTCGGGCTATCCCTCGTTTTCGCCGCTGCTGGTGGAGT
GGTTACAGGACAGCTGGCTGCTGGCCTCGGCCGAACTCCAGCACGCCCGCCTGCGTAGCGGCGTGCTGCT
GCTGGTGTTACTGATGACGCCGACGCGTTATCTGTCGGCCACGGTAACCCGCCAATTGGCGCAAATTAAC
CGTGAGCTGCTGCGCCAGCAGTTTGACGAGTGGGTGAAAGACTCGGCGGAAACCGAGGTGGTGACCGCCA
CAGGCGTCGCACCGGAGCAGGCCGCCGCCGCGACCACCCAACTGTCCCGCTATACCCAGAATGTCACCGA
GTCGGCCCGTCAGGGCAAGCTGGACCCGGTGTTATGCCGTGATCACGAAATTGACCTGATGATCGATATC
CTCTCCCGCCGTCGTAAAAATAACCCGATCGTGGTCGGTGAGGCCGGGGTAGGGAAAAGCGCGCTGATTG
AAGGGCTGGCGCTGCGTATCGTCGCGGGTCTGGTGCCGGAACGGCTGCGGGATGTGGAATTGCTGACGCT
GGATTTAGGTGCCATGCAGGCCGGTGCGTCGGTGAAAGGCGAGTTCGAGAAGCGCTTTAAAGGGGTGATG
CAGGAAGTCAAAGAGGCACCGAAGCCGATTGTCCTGTTTATTGACGAGGCGCACACACTGATTGGTGCGG
GTAATCAGGCCGGGGGGCTGGATGTGTCCAACCTGCTGAAACCGGCGCTGGCTCGGGGTGAGTTGCGCAC
CATCGCGGCGACCACCTGGAGCGAGTACAAGAAATACGTGGAAAAAGACGCCGCGCTGTCACGCCGCTTC
CAACTGGTGAAGGTGGGGGAGCCGAACGTCGAACAAGCCACGGTGATCCTGCGTGGGCTGCGCAGCATTT
ACGAACAGTCACACGGCGTGTTGATTGACGAAGAAGCCTTGCAGGCGGCGGCCAATTTGTCTGCGCGCTA
TATCTCCGGGCGTCAGTTGCCGGATAAAGCTATCGACGTGCTGGACACCGCCTGTGCGCGTGTCGCCATC
AATCTGACCACACCACCGCGTGCGGTCAGCCAGTTGCAGACCCGTCTGCACCAACAGGCGCTGGAAATCG
CCCAGTTGGAGCGTCAAGGCCGCATTGGCCTGGGGGATACAGAGGAGCGGCTGGTCACGCTGCGTGAGGC
TCGTGAAACCGACGCCGCGACACTGGCGCAACTGGAAGCCGACTGGCAGCGGCAAAAAACGCTGGTGCAG
CAGATCGTCGCCCTGCGTACCGCCCTGCTGGCTGATGAACCGGCGGCAGATTTCGATGCCGCCGCGGCCG
CCGCCGAGCTGGCCGACAGCGAGCGGGCGCTGGCCGAACTGCAACAACCGTCGGTGCTGGTATCGCCGCA
TGTGGATAAAACCCAGATTGCCTCGGTGATTGCCGAGTGGACCGGCGTACCGCTGAACCGTATTTCCCAG
GGCGAGCTGGATGTGGTCACCCGCCTGCCGGATTACCTCGGCGACAGCATCAAAGGGCAGCAACTGGCGA
TCGCCCAGTTGCACAAACACCTGCTGACCGCCCGTGCCGACCTGCGCCGTCCCGGTCGCCCGCTGGGCGC
GTTTTTACTGGTGGGGCCGAGCGGCGTGGGTAAAACCGAAACCGTGGTGCAGATTGCCGACCTGATGTTC
GGCGGTCGTCATTATCTCACCACCATCAACATGTCCGAGTACCAGGAGAAGCACACGGTTTCCCGCCTGA
TTGGTTCGCCGCCGGGCTATGTCGGCTTTGGCGAAGGCGGGGTGCTGACCGAAGCCATTCGCCAGAAACC
CTATTCGGTGGTGTTGCTGGATGAAGTGGAGAAAGCCCACCCGGATGTCCTCAACCTGTTCTATCAGGCG
TTTGATAAAGGCGAACTGGCCGATGGCGAAGGGCGGCTGATCGACTGTCGCAACGTGGTGTTCTTCCTGA
CCTCTAACCTCGGGTTCCAGACGATTGTCAATTTTGTGGAGCGCGTCAATTTTGCGGATCGGCAGGATGA
ACTGCTGGATGCGCTCTACCCGGAACTGGCGGCGTTCTTCAAACCGGCGTTGCTGGCGCGCATGGAAGTA
ATCCCATACCTGCCGCTGGACTACGACACGCTGGTTGAGATCGTACAGGGCAAGCTGTCCCGTCTGGTGA
CGTTGCTACAACAGCGCTTTGGTGCCGAGGTCGTCATCGACGCGACGGTGCCGGAAGAGATTTTGCGTCT
GGCGAACCGCAGCGAGAACGGCGCACGCATGTTGGAGTCGGTTATCGACGGCGCGTTGTTGCCGCCGGTG
TCGTTGCAGTTGTTGCAACGCTTGTCGGCCGGCCAGCCGGTCAGCCGTATTCATTTCCAGGTGGAAGACG
GCCAGTTCCGGTCCGAGGTGGAGGGCTGA