SecReT6
Protein ID: 251790381
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2799
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3181832..3182608 [-]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDC6CNU8
KEGG IDdze:Dd1591_2799
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.50E-71, Aligned region: 38..242
Protein Sequence: 258 a.a.     [Download]
>gi|251790381|ref|YP_003005102.1| type IV / VI secretion system protein, DotU family [Dickeya zeae Ech1591]
MSTDIIKNDQLGDLLYDNARQLDMDSDYWFRLRGQSINPMIDAVTPLLGMVERVRQLSEYGGVAELYQRV
QSEIQAIEQELHSHGYENGVILSFRYILCTFIDEAVMGREWGGQSVWSAHSLLTRFHNETWGGEKVFVLL
EKLLDDPVRYRDILEFIYLCLCLGFEGRYRVMTQGREELDRVVRRLHDTLRPEPENSPTVFHLNLGQQSS
RYQLRKQISLRTLFIGLCVVMAAAFGLYHYQLTNQTQDVLRQLGELLQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3182608-3181832 Dickeya zeae Ech1591 chromosome, complete genome
GTGAGTACCGACATCATTAAAAACGACCAGTTAGGTGACCTGTTGTATGACAACGCCCGACAACTGGATA
TGGATTCCGATTACTGGTTCCGCCTGCGCGGGCAGAGCATTAACCCGATGATCGACGCGGTGACCCCGCT
GCTGGGCATGGTGGAGCGGGTGCGCCAGCTGTCGGAATACGGCGGTGTGGCGGAGTTGTATCAGCGCGTG
CAGTCCGAAATTCAGGCCATCGAGCAGGAACTGCACTCCCACGGCTACGAAAACGGCGTGATCCTGTCGT
TTCGCTACATTCTGTGCACCTTCATTGACGAAGCGGTGATGGGGCGGGAGTGGGGCGGGCAGAGCGTGTG
GTCGGCCCATTCGCTGCTGACCCGCTTTCACAATGAAACCTGGGGTGGCGAGAAGGTGTTCGTGCTGCTG
GAGAAACTGCTGGATGACCCGGTGCGTTACCGCGACATTCTGGAGTTTATCTACCTGTGCTTGTGCCTCG
GTTTCGAAGGGCGCTACCGGGTGATGACGCAAGGGCGCGAAGAACTGGATCGGGTGGTGCGCCGCTTGCA
CGACACCCTGCGCCCGGAGCCGGAAAACTCGCCGACGGTGTTCCACCTCAATCTGGGGCAGCAGTCTTCC
CGCTACCAACTGCGTAAACAGATTTCGCTGCGCACCCTGTTTATCGGCCTGTGCGTGGTGATGGCGGCGG
CGTTTGGCCTCTACCACTATCAGCTAACCAACCAGACCCAGGACGTACTGCGTCAACTGGGAGAATTATT
ACAATAA