SecReT6
Protein ID: 251790382
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2800
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3182625..3183962 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDC6CNU9
KEGG IDdze:Dd1591_2800
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-157, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|251790382|ref|YP_003005103.1| type VI secretion protein [Dickeya zeae Ech1591]
MSSRNRIIWREGLFIKPQHFQQQQRHTDYALHARLSALSDYFYGLQSLAINEEYLNFGRIALVNATGVMP
DGTVFNIPGDDALPQPLEITDVALANQKVYLALPLAVNGVSEVGQAGAGIATRLQSHRHDVRDLHSEGGD
VVSMEVGKVSLRLMLERDDRSAYASLAIANILDKRPDGGLVLDPNFMPCSISVTAIASLKRFLGESAGLV
AERARSLAQRIAAPGQQGVADVAEFMMLQLLNRAQPQLSHLARLGTLHPERLHEALVQLCGELMTFTDES
RLPPEFPAYRHEHQQASFEPLMMALRQALSTVLSPRAVSIQMKAQPYGVRVALVGDAELMAGAEFVLAVR
ARMPQEHLRKQLLQQTKIASSDKIRELISLQLPGVPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWKSLVT
SNTLAFHIAGEFPELDMQLWAIRGQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3183962-3182625 Dickeya zeae Ech1591 chromosome, complete genome
ATGTCGAGCCGAAATCGGATTATTTGGCGGGAAGGGCTGTTCATCAAGCCGCAGCATTTCCAGCAACAGC
AAAGACACACGGACTACGCGCTCCATGCCCGTCTTAGCGCGCTTAGCGACTATTTCTACGGCCTGCAATC
GCTGGCAATCAACGAGGAATACCTCAACTTCGGGCGTATCGCGCTGGTGAACGCCACCGGCGTGATGCCG
GACGGCACGGTCTTCAACATTCCGGGGGATGACGCGCTGCCGCAACCGCTGGAGATTACCGATGTGGCGC
TGGCGAACCAGAAGGTCTATCTGGCACTGCCGCTGGCGGTGAACGGTGTGAGCGAAGTCGGGCAGGCCGG
GGCCGGTATTGCCACCCGTCTGCAATCGCATCGTCACGATGTGCGCGATTTGCACAGCGAAGGCGGCGAC
GTGGTGTCGATGGAAGTGGGCAAGGTCAGCCTGCGGCTGATGCTGGAACGCGATGATCGCAGCGCTTATG
CGTCGCTGGCGATCGCCAACATCCTCGACAAACGGCCGGACGGCGGGCTGGTGCTGGACCCTAACTTTAT
GCCTTGCAGCATCAGCGTTACCGCCATTGCGAGCCTGAAACGCTTTCTGGGGGAATCCGCCGGTCTGGTG
GCGGAACGCGCCCGCAGCCTGGCCCAGCGCATCGCCGCGCCCGGTCAGCAAGGGGTGGCGGACGTGGCGG
AATTCATGATGCTGCAACTGCTTAACCGCGCCCAGCCGCAGCTGTCGCATCTGGCGCGTCTCGGTACGCT
GCACCCGGAGCGGCTGCACGAAGCGCTGGTGCAACTGTGCGGCGAACTGATGACCTTTACCGACGAGTCG
CGCCTGCCGCCGGAGTTTCCCGCTTACCGGCACGAGCATCAGCAAGCGAGCTTCGAGCCGCTGATGATGG
CGCTGCGTCAGGCGCTGAGCACCGTGCTGTCGCCGCGTGCGGTGTCGATCCAGATGAAAGCGCAGCCTTA
CGGCGTGCGGGTGGCGCTGGTGGGCGATGCCGAACTGATGGCCGGCGCCGAATTTGTGCTGGCGGTGCGC
GCGCGTATGCCGCAGGAGCATCTGCGCAAGCAACTGCTGCAACAAACCAAGATCGCCTCCAGCGACAAAA
TTCGCGAACTCATCAGCCTGCAACTGCCCGGCGTGCCGCTGCTGCCGCTGCCGGTGGCGCCGCGCCAGCT
GCCGTATCACGCCGGCTACAGCTACTTCCAGTTGGACAGGCAAAGCCCGGCCTGGAAATCACTGGTCACC
AGCAACACGCTGGCGTTCCACATTGCCGGCGAATTCCCGGAACTGGACATGCAACTGTGGGCCATCCGCG
GCCAGTAG