SecReT6
Protein ID: 251790383
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2801
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3183965..3184501 [-]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDC6CNV0
KEGG IDdze:Dd1591_2801
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.20E-36, Aligned region: 16..169
Protein Sequence: 178 a.a.     [Download]
>gi|251790383|ref|YP_003005104.1| type VI secretion lipoprotein, VC_A0113 family [Dickeya zeae Ech1591]
MLRALMLRTGWLCVLMLLLPGCTTLGKMAKVAANPDIQIGSNDNQPSTIGFSLLAEPDVNPSESGDAAPI
EFQLVMLAEDSRLLATDYDQVTGDIEKALAKNYVSHQDYTLLPGQFKYLPPVKLDEKVHYIGVIAKYADP
DSAEWRKVIKLKNTGRTYQLLVHLRREEVEIKKDQEEE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3184501-3183965 Dickeya zeae Ech1591 chromosome, complete genome
ATGCTGCGAGCCTTAATGCTGCGAACCGGGTGGTTATGCGTTCTGATGCTGCTGCTTCCCGGTTGTACCA
CGCTTGGCAAGATGGCGAAGGTGGCTGCTAATCCGGATATTCAGATAGGCAGCAATGATAACCAGCCGTC
CACCATCGGTTTCAGCCTGCTGGCGGAGCCGGATGTTAACCCCAGCGAGAGCGGCGACGCGGCGCCCATC
GAGTTTCAACTGGTGATGTTGGCGGAGGATTCACGCCTGCTGGCGACCGACTATGACCAGGTGACCGGCG
ACATCGAAAAAGCGCTGGCTAAAAACTACGTCAGCCACCAGGACTACACGTTGCTGCCAGGGCAGTTCAA
ATACCTGCCGCCGGTCAAGCTGGACGAGAAAGTGCATTACATCGGGGTGATCGCCAAATACGCCGACCCG
GACAGCGCCGAGTGGCGCAAGGTTATCAAACTGAAAAACACCGGCCGCACTTATCAGCTTCTGGTGCATC
TGCGCCGTGAAGAAGTCGAAATCAAGAAAGATCAAGAAGAAGAATAA