SecReT6
Protein ID: 251790384
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2802
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3184501..3185730 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDC6CNV1
KEGG IDdze:Dd1591_2802
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.80E-06, Aligned region: 33..100
Protein Sequence: 409 a.a.     [Download]
>gi|251790384|ref|YP_003005105.1| FHA domain-containing protein [Dickeya zeae Ech1591]
MNENNPLTLVVLNSEQLDINSQVQHRFDHRGGTLGASEKDQWQLRDRLGAVLPEHARIELQDGHFCVCDL
SGQTFINGALSPIGRDRRVRLDHGDELVIGPFRLGVYLEDPAREQDIDQVLGQRPGDVLEGWLGEERRSA
PADETAIDRFNDPLWALQQEQSRSPLATEAERGDELPTSLSSFSAVEDTMDQKFVELPTIDNPHIDKPHA
GAGLGGQVDAVTLAPLLRGLGVSLNTGDEQQLRDMLEEMGKSLKAMVEGLLTLQADQAALADTHLRPIED
NPLRLGLDYTDTLSLLFADDKSPVHLSAPAAISEVLSNMQAHHRANQQAIAVALESILQAFSPAALLGRF
EHYRRSGERQALDDGWAWQMYQHYYRELTSPRQQGFQKLFHQVYAQAYDRAVRQQQEQK
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3185730-3184501 Dickeya zeae Ech1591 chromosome, complete genome
GTGAACGAAAACAACCCACTCACGCTGGTGGTGCTCAACAGCGAACAACTGGATATCAACTCGCAGGTGC
AGCACCGCTTTGATCACCGCGGCGGCACGTTGGGCGCATCGGAAAAGGATCAGTGGCAATTGCGCGACCG
ACTGGGCGCGGTATTACCGGAACATGCGCGCATCGAATTACAAGACGGCCATTTCTGCGTCTGCGACCTG
AGCGGCCAGACCTTCATCAACGGCGCGTTGTCGCCCATCGGCCGCGATCGCCGGGTACGGCTGGATCATG
GCGATGAACTGGTGATTGGCCCGTTCCGTCTGGGGGTTTACCTCGAGGATCCGGCGCGCGAGCAGGATAT
CGATCAGGTACTGGGGCAGCGCCCCGGCGATGTACTGGAAGGGTGGCTTGGCGAAGAACGACGTAGTGCG
CCCGCCGATGAGACGGCGATAGACCGATTTAACGACCCGTTGTGGGCGTTGCAGCAGGAACAGAGCCGCT
CGCCGCTGGCAACGGAGGCTGAGCGCGGCGATGAACTGCCGACCTCGCTTTCTTCTTTTTCTGCCGTTGA
GGACACCATGGATCAGAAATTTGTGGAATTACCGACCATTGACAATCCGCACATTGACAAGCCGCACGCC
GGGGCGGGGCTGGGCGGGCAGGTGGACGCGGTGACGCTGGCGCCGCTGCTGCGCGGGCTGGGCGTATCGC
TCAATACCGGCGATGAGCAGCAACTGCGCGACATGCTCGAAGAGATGGGCAAAAGCCTCAAAGCAATGGT
GGAAGGCTTGCTGACGTTGCAGGCCGATCAGGCGGCGCTGGCGGACACCCATCTACGGCCGATTGAAGAT
AACCCGCTGCGCCTGGGGCTGGATTACACCGATACGTTGTCGCTGCTGTTCGCCGACGATAAAAGCCCGG
TGCACCTGTCCGCACCGGCCGCCATCAGCGAGGTGCTCAGCAATATGCAGGCGCATCACCGGGCCAACCA
GCAGGCGATCGCCGTGGCGCTGGAAAGCATTTTGCAGGCGTTTTCTCCGGCGGCGCTGCTGGGGCGTTTC
GAGCATTACCGCCGCAGCGGCGAGCGTCAGGCGCTGGACGACGGCTGGGCGTGGCAGATGTACCAGCACT
ATTACCGCGAGCTGACCTCACCGCGTCAGCAAGGGTTTCAGAAACTGTTCCATCAGGTGTATGCGCAGGC
GTATGACCGCGCCGTTCGTCAGCAACAGGAGCAGAAATAA