SecReT6
Protein ID: 251790386
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2804
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3186710..3188476 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDC6CNV3
KEGG IDdze:Dd1591_2804
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.50E-199, Aligned region: 3..587
Protein Sequence: 588 a.a.     [Download]
>gi|251790386|ref|YP_003005107.1| type VI secretion protein [Dickeya zeae Ech1591]
MSLEHFFRDELAYLRLQGREFAKAHPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIEDEFPELTHGL
LGMLWPNYLRPVPSMTIMQFSVLPGAIAQPAFVARGCELDSLPIDDVVCHFQTCHDAWIYPADIHRINAQ
SGNDMSAITLDIGLHGPLSLGDLQLDKLRFFLGGDRYTAYELYFWIASQLSHIELEIDGKRFRQQANVLK
TVGFEREDAMLPYPGNVYSGYRILQEYFCFPESFLFFQLSGASWPNQPLMVTDFKLHFCFDRPLPAELKI
RPDSFMLNCVPAINLFRHDSEPINLDGRQTDYPLKASYRHADSFEIFSIDKVEGWVEGNSGRARGIPRLY
QPFESFQHQIERAKGRLALYYRIRVREAVSGDGFEHLLSFVRGDEKEVIDLDESISVSLTCTNRSRAAQL
PVGAICVPTGNSPSFATFRNLIRPTRPLRPALDGSLHWTLISNLSLNYVSLLRRDALVQILRTYDFPALH
DKQAEQASRKRLAGIETIETTPVDRLVQGMPVRGLKSVLSVRQSAFASEGELYLFSTVLAHFFSLYASVN
AFHLLEVVNIDNKERYRWPVQIGQHSMM
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3188476-3186710 Dickeya zeae Ech1591 chromosome, complete genome
ATGTCGCTGGAACATTTCTTCAGGGATGAACTCGCTTATTTGCGCCTGCAAGGGCGCGAATTCGCCAAAG
CACACCCTGAACTTACCCGATTTTTGTCAGAACAGACCACGGATCCGGATGTCGAGCGGTTGCTGGAAGG
CTTCGCCTTTTTGACCGGCAGTTTGCGGGCGAAGATCGAGGATGAGTTTCCGGAGCTGACGCACGGCCTG
CTGGGTATGCTGTGGCCGAACTATTTGCGCCCGGTCCCCAGCATGACCATCATGCAGTTTTCGGTACTGC
CCGGCGCCATCGCGCAGCCGGCGTTCGTGGCGCGCGGCTGCGAGCTGGACAGCCTGCCGATCGACGATGT
GGTCTGTCATTTCCAGACCTGCCACGATGCCTGGATCTACCCGGCGGATATCCACCGGATCAACGCGCAA
AGCGGCAACGACATGTCCGCCATCACGCTGGATATCGGCCTGCACGGGCCGTTGTCGCTGGGGGATTTGC
AGCTCGATAAACTGCGTTTCTTCCTGGGCGGCGACCGTTACACCGCCTATGAACTCTATTTCTGGATAGC
CAGCCAGTTATCGCACATTGAGCTGGAAATTGACGGGAAACGCTTTCGCCAGCAGGCGAATGTGCTGAAA
ACCGTCGGTTTTGAGCGCGAAGACGCGATGCTGCCGTATCCCGGCAACGTCTACTCCGGCTACCGCATCC
TGCAGGAGTATTTCTGTTTTCCGGAAAGTTTTCTGTTCTTCCAGTTGTCCGGCGCCAGTTGGCCTAACCA
GCCGTTGATGGTGACGGATTTCAAACTGCATTTCTGCTTTGACCGGCCGCTGCCGGCGGAACTGAAAATC
CGTCCGGATTCGTTCATGCTCAACTGCGTGCCGGCCATCAATCTGTTCCGCCATGACAGCGAACCGATCA
ACCTGGATGGTCGCCAGACGGATTACCCGCTCAAAGCCAGCTATCGCCACGCCGACAGCTTCGAGATTTT
TTCCATCGACAAAGTGGAAGGCTGGGTGGAGGGCAACAGCGGGCGCGCGCGCGGCATTCCGCGGCTCTAC
CAGCCGTTCGAAAGTTTCCAGCACCAAATCGAACGAGCCAAAGGGCGGCTGGCGCTGTATTACCGCATTC
GGGTGCGTGAAGCGGTCAGCGGCGACGGCTTTGAGCATTTGCTGTCGTTTGTGCGCGGCGACGAGAAAGA
GGTTATCGATCTGGATGAGTCCATTTCGGTTAGCCTGACCTGCACCAACCGCTCGCGGGCGGCGCAGTTG
CCGGTGGGCGCCATCTGCGTGCCGACCGGCAATTCGCCGTCTTTCGCTACCTTCCGCAACCTGATTCGGC
CCACCCGCCCGCTGCGCCCGGCGTTGGACGGCAGCCTGCACTGGACGCTGATCTCCAACCTGTCGCTGAA
CTATGTGTCGCTGCTGCGCCGTGATGCGCTGGTGCAGATCTTGCGTACCTACGACTTTCCGGCGTTGCAT
GACAAGCAGGCGGAGCAGGCGTCGCGCAAGCGGCTGGCGGGGATAGAAACGATTGAAACCACACCGGTGG
ACCGGCTGGTGCAGGGGATGCCGGTGCGCGGGCTCAAGTCGGTTTTGTCGGTGCGGCAGTCGGCGTTCGC
CAGTGAAGGCGAACTCTATCTGTTCAGCACCGTGCTGGCGCATTTCTTCTCGTTGTACGCCAGCGTCAAC
GCCTTCCATCTGCTGGAAGTGGTCAATATCGATAACAAGGAGCGCTACCGATGGCCGGTACAGATAGGTC
AGCACTCGATGATGTGA