SecReT6
Protein ID: 251790387
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2805
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3188479..3188910 [-]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDC6CNV4
KEGG IDdze:Dd1591_2805
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-20, Aligned region: 31..123
Protein Sequence: 143 a.a.     [Download]
>gi|251790387|ref|YP_003005108.1| type VI secretion system lysozyme-related protein [Dickeya zeae Ech1591]
MPSLSAWERGSAASLFDRIRGEERRSSPETELEDLIASVKRQLDQVLNTRPGSCRSAPELGVIDFNDATQ
GGADIRGKIREAIRQCICRFEPRIVHVDVSASDYLSNPLEMSFQVTAHVRLEELEQVTSFNIHMDSHRHY
RMM
 
Nucleotide Sequence: 432 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3188910-3188479 Dickeya zeae Ech1591 chromosome, complete genome
ATGCCGTCGCTCTCTGCCTGGGAGCGGGGATCTGCGGCCAGCCTGTTTGATCGTATCCGGGGAGAGGAGC
GCCGTTCCTCTCCCGAAACGGAGTTGGAAGACCTGATCGCGTCGGTGAAACGCCAGCTTGATCAGGTACT
GAATACGCGCCCCGGCAGTTGTCGCAGCGCACCCGAGCTTGGCGTGATTGATTTTAATGACGCCACGCAG
GGCGGCGCGGATATCCGGGGCAAAATCCGTGAAGCGATCCGACAGTGTATCTGTCGCTTTGAACCGCGCA
TTGTCCATGTGGACGTCAGTGCATCGGACTATCTGTCCAACCCGCTGGAGATGTCGTTTCAGGTCACCGC
ACATGTGCGGCTGGAAGAACTGGAGCAGGTCACCTCCTTCAATATTCATATGGACAGCCACCGCCATTAC
AGAATGATGTGA