SecReT6
Protein ID: 251790388
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2806
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3188917..3190395 [-]
ProductEvpB/VC_A0108 family type VI secretion protein
NoteTssC
UniProt IDC6CNV5
KEGG IDdze:Dd1591_2806
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-186, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|251790388|ref|YP_003005109.1| EvpB/VC_A0108 family type VI secretion protein [Dickeya zeae Ech1591]
MSMVEEQAQTSAAGGSSSLLEEIMAQARITPVDEGYNVAKQGIAALVANILDSGNAAEPVNKALVDSMIV
ELDKKLSKQIDVILHAQELQELESSWRSLKLLIDRTDFRENIKILLLHATKNELLEDFEFAPEITQSGFY
KHVYSSGYGQFGGQPIGGVIGDYALTQSSPDIKLMQYVSAVGAMAHAPFISSVAPTFFGVDSFTDLPSIK
DLKSVFEGPAYTKWRSMRESEDARYLGLTAPRFLARLPYDPVENPIKGFHYKEDISANHEHYLWGNTAYL
MGTAITDSFAKYRWCPNIIGPQSGGAITDLPVHVYEAMGQLQAKIPTEVLITDRREYEMAEEGFITLTMR
KDSDNAAFFSANSVQKPKVFANTKEGKEAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNNWIKQYVADQENPPADVRSRRPLRAAQIKVLDVEGEPGWYQVTMAVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3190395-3188917 Dickeya zeae Ech1591 chromosome, complete genome
ATGTCAATGGTTGAAGAACAGGCCCAGACAAGCGCGGCCGGTGGTTCATCATCGCTGCTTGAAGAAATCA
TGGCGCAGGCGCGCATCACCCCGGTGGATGAAGGTTACAACGTCGCCAAACAGGGGATCGCCGCGCTGGT
GGCGAACATTCTGGACAGCGGCAACGCGGCCGAGCCGGTGAACAAGGCGCTGGTCGACAGCATGATCGTT
GAGCTGGACAAAAAACTCAGCAAACAGATCGACGTGATTCTTCATGCACAGGAGTTGCAGGAGCTGGAAT
CTTCCTGGCGCTCACTGAAACTGCTGATCGATCGCACCGATTTCCGTGAAAACATCAAAATCCTGCTGCT
GCACGCGACCAAAAACGAGCTGCTGGAAGACTTTGAGTTTGCACCGGAAATTACCCAGTCCGGTTTCTAT
AAACACGTTTATTCCAGCGGCTACGGCCAGTTCGGCGGCCAGCCGATCGGCGGGGTGATCGGCGATTACG
CGCTGACTCAAAGCTCGCCGGACATCAAGCTGATGCAGTATGTCAGCGCGGTGGGCGCGATGGCGCACGC
ACCGTTCATCTCCTCCGTCGCACCGACCTTCTTCGGTGTGGACAGCTTTACCGATCTGCCGTCGATCAAA
GACCTGAAATCGGTATTCGAAGGCCCGGCTTACACCAAATGGCGTTCGATGCGCGAATCGGAAGATGCCC
GCTATCTGGGGCTGACGGCGCCGCGTTTCCTGGCTCGCCTGCCGTATGACCCGGTAGAAAACCCCATCAA
AGGGTTTCACTACAAGGAAGACATCAGCGCCAACCACGAACACTACCTGTGGGGCAACACCGCGTATCTG
ATGGGGACCGCCATCACCGACAGCTTCGCCAAGTACCGCTGGTGCCCGAACATTATCGGCCCGCAAAGCG
GCGGCGCCATCACCGATCTGCCGGTGCATGTGTATGAAGCGATGGGCCAGTTGCAGGCCAAGATTCCGAC
CGAGGTGTTGATCACCGACCGTCGCGAATACGAAATGGCCGAAGAGGGTTTCATCACCCTGACCATGCGT
AAAGACAGCGATAACGCCGCGTTCTTCTCCGCCAACTCGGTGCAGAAACCCAAGGTGTTCGCCAATACCA
AAGAAGGGAAAGAGGCGGAAACCAACTACAAACTGGGTACGCAACTGCCGTACATGTTCATCATCAACCG
CCTGGCGCACTACATCAAAGTGTTGCAGCGCGAGCAAATCGGTTCCTGGAAAGAGCGTCAGGATCTGGAG
CGCGAGCTGAATAACTGGATCAAGCAGTACGTCGCCGATCAGGAAAACCCGCCGGCTGATGTACGCAGCC
GCCGTCCGCTGCGTGCGGCACAGATCAAAGTGCTGGATGTGGAAGGCGAACCGGGCTGGTATCAGGTGAC
CATGGCGGTGCGCCCGCACTTCAAGTACATGGGGGCGAACTTTGAATTGTCCCTGGTTGGTCGTCTGGAT
AAGGAATAA