SecReT6
Protein ID: 251790389
SecReT6 ID351
T6SS typei1
Gene symbol-
Locus tagDd1591_2807
StrainDickeya zeae Ech1591
Repliconchromosome [GenBank: NC_012912] [Browse all T6SS(s) in this replicon]
Location [Strand]3190427..3190930 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDC6CNV6
KEGG IDdze:Dd1591_2807
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 9..161
Protein Sequence: 167 a.a.     [Download]
>gi|251790389|ref|YP_003005110.1| type VI secretion protein [Dickeya zeae Ech1591]
MAKGTDGASVAPKERINIKYVPATGGQQAEIELPLTLMVVGNMKGRTEETPIEERQTVSIDKNNFTSVMK
EANLELNFSVPNRLEEDSQDDLPVKLSIASLNDFSPDRIAQQVPELRKLLELREALVALKGPLGNIPAFR
NRLQDLLSSEEAREQLLKELDLVKPAE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|251787652|ref|NC_012912.1|:c3190930-3190427 Dickeya zeae Ech1591 chromosome, complete genome
ATGGCAAAAGGAACTGACGGTGCATCTGTCGCACCAAAGGAACGTATTAATATCAAATATGTCCCAGCTA
CGGGTGGTCAGCAGGCGGAAATTGAATTACCGCTGACGTTGATGGTAGTGGGAAATATGAAGGGACGCAC
AGAAGAGACACCGATTGAAGAACGTCAGACGGTGTCTATCGACAAGAACAATTTCACTTCGGTCATGAAA
GAGGCCAATCTGGAGCTGAATTTCAGCGTGCCTAACCGCCTGGAAGAAGACAGCCAGGATGACCTCCCCG
TCAAACTCAGTATCGCTTCACTGAATGATTTCTCCCCCGATCGCATCGCCCAGCAAGTACCGGAACTGCG
CAAGCTGCTGGAACTGCGCGAAGCGCTGGTGGCGCTGAAAGGGCCGCTGGGTAATATCCCCGCTTTCCGC
AATCGCCTGCAGGATCTGTTATCCAGCGAAGAAGCCAGAGAGCAGTTGCTTAAAGAGCTGGATCTGGTGA
AACCCGCCGAATAA