SecReT6
Protein ID: 251793536
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1851
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1837937..1838434 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDC6AQR8
KEGG IDaap:NT05HA_1851
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-57, Aligned region: 5..159
Protein Sequence: 165 a.a.     [Download]
>gi|251793536|ref|YP_003008265.1| type VI secretion protein [Aggregatibacter aphrophilus NJ8700]
MSKTGSVAPKERINIKYTPATGNQQEEVELPLKLLVTGDFKGAPEETSLDERETVSVDKHNFDAVMKQSA
LKIDMAVPNRLDDNAGNQDIGVSLKIESMADFSPDNIAKQVPQLNKLLELREALLALKGPMGNIPAFRNK
LQDLISDQSAREALEKELAIILEKE
 
Nucleotide Sequence: 498 bp     [Download]
>ref|NC_012913.1|:1837937-1838434 type VI secretion protein [Aggregatibacter aphrophilus NJ8700]
ATGTCAAAAACAGGTTCAGTCGCACCTAAAGAGCGAATTAATATTAAATATACACCAGCCACAGGAAACC
AACAGGAAGAAGTTGAGTTACCACTAAAATTACTTGTGACAGGTGACTTCAAAGGTGCCCCAGAGGAAAC
AAGTCTTGATGAAAGAGAAACAGTCTCTGTTGATAAACACAATTTTGATGCAGTAATGAAGCAGTCTGCT
TTAAAAATTGATATGGCAGTGCCAAACCGTTTAGACGACAACGCTGGAAACCAAGATATTGGTGTTAGCT
TAAAAATTGAAAGTATGGCAGATTTTTCTCCTGATAATATTGCTAAGCAAGTTCCTCAATTAAATAAATT
ATTAGAATTACGAGAAGCTCTCTTAGCATTAAAAGGTCCAATGGGAAACATTCCCGCATTTAGAAATAAA
TTACAAGATTTAATTTCTGATCAAAGTGCGAGAGAGGCATTAGAAAAAGAACTCGCTATTATTTTAGAGA
AAGAATAA