SecReT6
Protein ID: 251793537
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1852
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1838456..1839940 [+]
Producttype VI secretion protein, EvpB/family
NoteTssC
UniProt IDC6AQR9
KEGG IDaap:NT05HA_1852
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-187, Aligned region: 65..489
Protein Sequence: 494 a.a.     [Download]
>gi|251793537|ref|YP_003008266.1| type VI secretion protein, EvpB/family [Aggregatibacter aphrophilus NJ8700]
MVAKNKAAQTEQQATTTSLLDQVMEQTRFKPENEDYTIAQRGIAEFISEMLKTDNTDAVVNKTLIDEMIV
RLDEKIGHQVDEILHNQKLQEIESAWRGLKLLVDRTDFRENIKIEVLNVTKEELLDDFEYATDITQSGLY
KHVYSANYGQFGGEPVAAIVGNYTFTPAAPDIKLLQYVSSVGAMSHAPFISAAGPEFFGLDSYASLSEIK
EVKDIFEGPRYAKWRALRESEDSKYLALTMPRFLSRLPYDPIENPTKRFNYQETIAGEHNNYLWSNVAFL
MASKVTESFAKYRWCPNIIGPQSGGAVEDLPVHLFESFGQLQAKIPTEVLITDRKEFELADEGFIPLTMR
KGSDNAAFFSANSVQKPKKFPNTEEGKLAETNYKLGTQLPYMFIVNRLAHYLKVLQREQIGSWKERQDLE
RELNVWLKQYVSDQENPPAEVRSRRPLRAAKVEVSSVAGEPGWYKVSLSVRPHFKYMGASFDLSLVGRLD
LDDK
 
Nucleotide Sequence: 1485 bp     [Download]
>ref|NC_012913.1|:1838456-1839940 type VI secretion protein, EvpB/family [Aggregatibacter aphrophilus NJ8700]
ATGGTTGCAAAAAATAAGGCGGCTCAAACAGAACAACAAGCGACAACAACAAGCTTGCTTGATCAGGTAA
TGGAACAAACTCGTTTTAAACCTGAGAATGAAGATTATACTATTGCTCAGCGTGGTATTGCAGAATTTAT
TTCTGAAATGTTAAAAACCGATAATACTGATGCGGTAGTAAATAAAACACTTATCGATGAGATGATTGTC
CGTCTTGACGAAAAAATTGGTCATCAAGTAGATGAAATTTTACATAATCAAAAATTACAAGAAATTGAGT
CTGCATGGCGTGGTTTAAAATTACTAGTAGACAGAACTGACTTCCGCGAAAATATTAAAATAGAAGTTTT
AAACGTAACCAAGGAAGAACTCTTAGACGATTTTGAATATGCGACAGACATTACTCAAAGCGGTCTATAT
AAACATGTTTATTCAGCAAATTACGGACAGTTTGGTGGTGAACCGGTAGCAGCAATTGTTGGTAACTATA
CATTCACACCAGCAGCACCAGATATTAAATTGTTACAATACGTTTCTTCCGTAGGCGCTATGTCTCATGC
GCCATTTATCTCAGCGGCAGGTCCTGAATTCTTTGGTTTAGATAGTTATGCATCACTTTCTGAAATCAAA
GAAGTCAAAGATATTTTTGAAGGTCCTAGATACGCAAAATGGCGGGCCTTACGAGAATCTGAAGATTCAA
AATACTTGGCCTTAACTATGCCTCGTTTCTTATCTCGTTTGCCGTATGATCCAATTGAAAATCCAACAAA
AAGATTTAACTATCAAGAAACTATCGCTGGTGAGCACAACAATTACTTATGGAGTAACGTCGCATTCTTA
ATGGCTTCAAAAGTAACTGAAAGTTTTGCTAAATACCGTTGGTGTCCAAATATTATTGGTCCTCAAAGCG
GTGGTGCCGTTGAAGATTTACCAGTTCACTTATTTGAGTCCTTTGGTCAACTACAAGCTAAAATTCCAAC
TGAAGTGCTAATTACTGATCGTAAAGAATTTGAACTTGCTGATGAGGGATTTATCCCTTTAACGATGCGT
AAAGGTAGTGATAATGCAGCATTCTTCTCAGCAAACTCAGTGCAAAAACCTAAGAAATTCCCGAATACAG
AGGAAGGCAAACTCGCTGAAACAAACTATAAACTTGGTACTCAACTACCTTACATGTTTATTGTGAATCG
CTTAGCACATTACTTAAAAGTATTACAACGTGAGCAAATTGGTTCATGGAAAGAGCGTCAAGATCTTGAA
CGTGAGCTAAATGTGTGGCTAAAACAATATGTTTCAGATCAAGAAAACCCACCAGCAGAGGTACGCAGCC
GTCGTCCATTACGAGCAGCTAAAGTAGAAGTGTCCAGTGTAGCTGGAGAACCAGGCTGGTATAAAGTTTC
ATTATCTGTACGTCCACACTTTAAATATATGGGAGCAAGTTTTGATCTTTCTCTTGTTGGTCGTTTAGAT
CTTGATGATAAATAA