SecReT6
Protein ID: 251793538
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1853
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1839950..1840366 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDC6AQS0
KEGG IDaap:NT05HA_1853
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.90E-17, Aligned region: 28..119
Protein Sequence: 138 a.a.     [Download]
>gi|251793538|ref|YP_003008267.1| type VI secretion system lysozyme-like protein [Aggregatibacter aphrophilus NJ8700]
MSFWNRIKEASKETKTIVKKSESEIISELIRSIKKNIELVLNSKQGCTLCAPDFGLRDFNDSTATTRSLS
QTIIADIRFNIERYEPRVRISRIEYIPDPYDVLQLNFRITCVVLLKQKNELTELNIILDSSNKRFKVV
 
Nucleotide Sequence: 417 bp     [Download]
>ref|NC_012913.1|:1839950-1840366 type VI secretion system lysozyme-like protein [Aggregatibacter aphrophilus NJ8700]
ATGAGTTTTTGGAATCGAATTAAAGAAGCCTCAAAAGAAACAAAAACGATTGTTAAAAAAAGCGAATCAG
AAATTATTAGTGAACTGATTCGCTCAATCAAGAAAAACATAGAATTGGTTCTCAACTCCAAACAAGGGTG
CACATTATGTGCACCTGATTTTGGTTTAAGGGATTTCAACGATTCAACAGCAACAACACGTAGTTTAAGC
CAAACAATTATTGCTGATATCCGCTTTAATATTGAACGTTATGAGCCTCGAGTAAGAATCTCAAGAATTG
AATATATTCCGGATCCTTATGATGTCCTACAGCTTAATTTTCGTATAACGTGCGTCGTGTTATTAAAGCA
GAAAAATGAATTAACTGAGTTAAATATTATTTTAGATAGTTCCAACAAAAGATTTAAGGTTGTGTAG