SecReT6
Protein ID: 251793539
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1854
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1840367..1842118 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDC6AQS1
KEGG IDaap:NT05HA_1854
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-175, Aligned region: 4..581
Protein Sequence: 583 a.a.     [Download]
>gi|251793539|ref|YP_003008268.1| type VI secretion protein [Aggregatibacter aphrophilus NJ8700]
MSLKEFFRAELDFLKKDGRHFSKAYPHLSRFLSDEIIDPEAERIIESFAFLTARLKEKIQDNLPELTQSM
MQLLWPNYLRPLPSCAILKFSPKDRSITTKHIIPKGTLVSSKPVDGTPCQFQTTMDVSVYPILLNSVTSS
TATETTFIEFNLENISDGDFASLKCDELSFYLSGSDYSALTCYQWIFNYLTKIYVKAGEDIIKLPVDCIE
PQGFSENEALIPYPENAFNGYRLIQEFFFFPKKFYFFKLRKLQILLKSLTQKNFKLLFEFNRPLPKDLKL
TSSDFSLYCSPIINLFEHDAIPINFDGKKVLYPVIPVGFNRSHFEIFSITDVLGSSMIKDPSRNNRIQQY
SNFESFAHNNTSTGFYKSVIKESVEEDGYEYYVSFVSREHKNLEGIRETISINLKCTNHNLPELLGIGDI
CMPSQNTPSYIEFKNITLPIKTVRPILDEELHWKLISNLSLNYLSLTHLDVLRDVLSTYDFPAINDIQAR
RRTEKRLSGIESLETKKSDRIIKGIIYRGQKSTLRIDSNTFLCEGELFLFGAILSEFFRLYGTINSFHFL
EVINTNNNETFKWEQKSSLQNMI
 
Nucleotide Sequence: 1752 bp     [Download]
>ref|NC_012913.1|:1840367-1842118 type VI secretion protein [Aggregatibacter aphrophilus NJ8700]
ATGTCTTTGAAAGAATTTTTTAGAGCCGAGTTAGATTTCTTAAAAAAAGATGGTCGGCATTTCTCAAAGG
CTTACCCTCACTTATCTCGTTTTTTGTCTGATGAAATTATTGATCCTGAGGCAGAAAGAATTATAGAGTC
TTTTGCTTTTCTTACTGCTCGCCTAAAAGAAAAAATTCAAGATAATTTACCTGAATTAACTCAATCTATG
ATGCAGCTACTTTGGCCTAACTATCTACGACCTTTACCTAGCTGTGCAATTTTAAAATTTTCACCCAAGG
ATCGCTCGATCACAACAAAACATATTATTCCTAAAGGAACTCTTGTTTCATCAAAACCAGTAGATGGCAC
CCCATGTCAATTTCAGACAACTATGGATGTTTCTGTTTACCCGATTTTATTAAATTCAGTAACAAGCAGT
ACAGCAACAGAAACAACTTTTATAGAATTTAACTTAGAAAATATTTCAGATGGTGACTTTGCATCACTAA
AATGTGATGAATTATCTTTCTATTTATCCGGTAGTGATTATAGCGCGTTAACCTGCTATCAATGGATTTT
TAATTATTTAACTAAAATCTATGTTAAAGCAGGCGAAGACATTATAAAACTGCCTGTAGATTGCATTGAG
CCTCAAGGATTTAGTGAAAATGAAGCTTTAATACCATATCCAGAGAATGCCTTTAATGGGTATAGATTAA
TACAAGAATTTTTCTTTTTTCCTAAAAAATTTTACTTTTTTAAACTAAGAAAATTGCAAATACTTTTAAA
ATCTCTGACTCAAAAAAATTTTAAATTATTATTTGAGTTTAATAGACCTTTACCAAAAGATTTAAAACTA
ACTAGTTCAGATTTTTCACTCTATTGCTCACCTATTATTAATTTATTTGAGCATGATGCAATTCCTATTA
ATTTTGATGGAAAAAAGGTTTTATATCCAGTCATTCCTGTAGGTTTTAATCGTAGTCATTTTGAAATTTT
TAGTATAACAGATGTTCTAGGATCATCAATGATCAAAGATCCTTCTAGAAACAACAGGATTCAGCAGTAT
TCAAATTTTGAATCCTTTGCACATAACAATACATCTACTGGATTCTATAAATCAGTAATAAAAGAGAGTG
TTGAAGAAGATGGATATGAATATTATGTTTCTTTTGTATCTAGAGAACATAAAAACTTAGAAGGAATAAG
AGAAACAATCTCAATTAATCTAAAATGTACAAACCATAATTTACCTGAATTACTTGGTATTGGTGATATT
TGTATGCCATCGCAAAATACACCATCTTATATAGAATTTAAAAATATAACTCTTCCAATAAAAACTGTGA
GACCTATATTAGATGAAGAGCTTCATTGGAAATTAATTTCTAATTTATCATTAAATTACTTATCCTTAAC
TCACTTAGATGTGCTAAGAGATGTTCTTTCAACCTATGACTTCCCTGCAATAAATGATATACAAGCCCGA
AGAAGAACAGAAAAGAGATTATCAGGAATAGAATCTTTAGAGACCAAAAAGTCAGATAGAATTATAAAAG
GTATTATTTATAGAGGTCAAAAATCAACTTTAAGGATAGATAGCAATACTTTCTTATGTGAAGGTGAATT
ATTTTTATTTGGCGCTATTTTATCTGAGTTTTTTAGACTATATGGAACCATTAATTCATTTCATTTTCTA
GAGGTAATTAATACAAATAATAACGAGACATTCAAATGGGAACAGAAGAGCTCTCTCCAAAATATGATCT
AA