SecReT6
Protein ID: 251793540
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1855
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1842082..1843080 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDC6AQS2
KEGG IDaap:NT05HA_1855
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.90E-67, Aligned region: 13..314
Protein Sequence: 332 a.a.     [Download]
>gi|251793540|ref|YP_003008269.1| type VI secretion protein [Aggregatibacter aphrophilus NJ8700]
MGTEELSPKYDLTDFNFHQLIEVVAKASSANLELLENTLLEDSLYLFSSNPKISFPLGDIEKVNIINRDN
KTQFNIVVNFLGLQGSSGPLPGSVLDEIAEEFYESEHIKIKYLDFFNHHLISLLHQIWRKYKYYIKFKED
FSDIYSKNMMSLIGISREYSEYSHLKWDKIFYYLGIIQSRIRTPQVLSTIIQYYFSLDKVEIKEHARQLV
QLNSEQRSSLGNNNMMLGDDFIAGDVVESFSNKFEVAIHNLDISQFYQFLPLGHKYTELKELIRFLLKDP
LPYDISLGLHPQTHSTFVLGENKSSLLGWTTLLNSAFDNSYSLDAVTIEGQR
 
Nucleotide Sequence: 999 bp     [Download]
>ref|NC_012913.1|:1842082-1843080 type VI secretion protein [Aggregatibacter aphrophilus NJ8700]
ATGGGAACAGAAGAGCTCTCTCCAAAATATGATCTAACAGATTTTAACTTTCACCAACTTATTGAAGTAG
TGGCAAAAGCATCATCAGCCAATTTAGAATTATTAGAAAATACTCTATTAGAAGATTCATTATATCTATT
TTCAAGCAATCCTAAAATTAGTTTCCCACTTGGTGATATTGAGAAAGTAAATATCATAAATAGAGATAAT
AAGACTCAATTTAATATTGTAGTAAATTTTTTAGGGTTACAAGGCTCCTCTGGGCCATTACCTGGGTCTG
TTTTAGATGAAATTGCTGAAGAGTTTTATGAGAGTGAGCATATAAAGATAAAATATTTAGACTTCTTTAA
TCACCACCTCATTAGTCTTTTACATCAAATTTGGAGAAAGTATAAATACTATATTAAATTTAAAGAAGAC
TTCTCAGATATTTATTCAAAGAATATGATGAGTCTTATTGGCATATCTAGAGAATATTCAGAATATTCTC
ATCTAAAATGGGATAAGATCTTCTATTACCTAGGAATAATCCAATCTAGAATTAGAACTCCTCAAGTTCT
AAGTACTATAATTCAATATTATTTCTCCTTAGATAAGGTTGAAATAAAAGAACATGCACGCCAATTAGTT
CAATTAAACTCAGAACAAAGAAGTTCTCTTGGTAACAATAATATGATGTTAGGTGATGATTTTATTGCAG
GTGATGTCGTTGAATCTTTTTCGAATAAATTTGAGGTGGCTATACATAATTTAGATATCAGCCAATTCTA
CCAGTTCTTACCCTTAGGCCATAAGTATACGGAATTAAAAGAATTGATCCGTTTTTTACTGAAGGATCCT
TTACCTTACGATATCTCTTTAGGATTACATCCTCAAACTCATTCAACTTTTGTTTTAGGAGAAAATAAAT
CTAGTCTTTTAGGATGGACTACATTATTAAATTCAGCATTTGATAATTCATATTCTTTAGATGCAGTAAC
AATAGAGGGACAACGATAG