SecReT6
Protein ID: 251793541
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1856
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1843082..1843867 [+]
Producthypothetical protein
NoteFha
UniProt IDC6AQS3
KEGG IDaap:NT05HA_1856
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 261 a.a.     [Download]
>gi|251793541|ref|YP_003008270.1| hypothetical protein NT05HA_1856 [Aggregatibacter aphrophilus NJ8700]
MHKLLLMVTHAFMLEKGTLPHCHFNQQGGIIGASKTANWKINNFKNEISDIEFEIKYYDADYCLIAHTSN
IFINKSSYALPIGGIIRLKDNDIISLFNYEIRAKIFTNQAEIVTLQDELSFLVNNPSDKMVIGENNLKLE
DFSLHTKTLQNTEKLLTLNQTELDPLLALKDSDITEDILNLGSSYMIDSDYKFFNPNINSSLEYYDPIEL
NILNKKDEASVNNLYNTPQDVFASLKPVTSIKSGDREEHDEEMLDPLFFIE
 
Nucleotide Sequence: 786 bp     [Download]
>ref|NC_012913.1|:1843082-1843867 hypothetical protein NT05HA_1856 [Aggregatibacter aphrophilus NJ8700]
ATGCATAAACTTCTTCTTATGGTTACACATGCTTTTATGCTTGAGAAAGGAACTCTTCCCCATTGTCATT
TTAATCAACAGGGCGGGATCATTGGTGCCAGCAAGACAGCAAACTGGAAGATAAATAATTTTAAAAATGA
AATTTCTGATATTGAATTTGAAATAAAATATTACGATGCTGATTATTGTCTAATTGCGCATACATCAAAT
ATTTTTATCAACAAATCTTCTTATGCTCTTCCTATAGGAGGAATAATTCGCTTAAAAGATAACGACATTA
TATCATTATTTAATTATGAAATAAGAGCTAAAATATTCACAAACCAGGCTGAAATAGTGACCTTACAAGA
TGAACTATCCTTTCTAGTAAATAACCCTTCAGATAAAATGGTTATTGGAGAAAATAATCTAAAACTAGAG
GACTTTTCTCTCCATACTAAAACGTTACAAAACACTGAAAAATTGTTAACGCTAAATCAAACAGAATTAG
ATCCGTTACTAGCGCTCAAAGATTCAGATATCACTGAAGATATCTTGAATTTAGGCTCATCTTACATGAT
AGATTCTGACTATAAGTTTTTTAACCCCAATATAAATAGTAGCTTAGAATATTATGACCCAATAGAGCTA
AACATTTTAAACAAGAAAGATGAAGCGTCGGTAAATAATCTATATAATACACCGCAAGATGTTTTTGCAT
CTTTAAAACCTGTCACTTCCATAAAAAGTGGAGACAGAGAAGAACATGATGAGGAAATGCTAGATCCTCT
ATTTTTTATAGAATAA