SecReT6
Protein ID: 251793542
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1857
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1843882..1844568 [+]
Producttype VI secretion lipoprotein, family
NoteTssJ
UniProt IDC6AQS4
KEGG IDaap:NT05HA_1857
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.30E-23, Aligned region: 13..48
T6SS-SciN [PF12790], Evalue: 7.30E-23, Aligned region: 109..220
Protein Sequence: 228 a.a.     [Download]
>gi|251793542|ref|YP_003008271.1| type VI secretion lipoprotein, family [Aggregatibacter aphrophilus NJ8700]
MKLKQLFTLIPTLIIVGCSSNEPGENPRLSKASTYSLSIYATDRANINIYSPKDDAISVVSDEVNMDYDS
SAFDSPKGETKRPRSANEYKNNLKASSSNPSNDKQVIQQENGKADLRATPVMLKVFQLTDKSLFLSSTYD
DFRGSDFTDSLGKTYISNIDLIIAPNQFRFIEPEALNEKTHYIGVVALFNGYENRKWKGIVQVRPKGGES
YPLLIRVLDSKVEIYKDN
 
Nucleotide Sequence: 687 bp     [Download]
>ref|NC_012913.1|:1843882-1844568 type VI secretion lipoprotein, family [Aggregatibacter aphrophilus NJ8700]
ATGAAACTAAAACAACTATTTACACTAATCCCTACGCTGATCATTGTGGGATGTTCTTCTAATGAACCAG
GAGAAAACCCGCGACTGTCTAAAGCGTCAACATATTCACTTTCTATCTATGCTACTGATCGTGCAAATAT
TAACATTTACTCTCCAAAGGACGATGCAATTTCAGTTGTAAGTGATGAAGTAAATATGGATTATGATAGT
TCAGCTTTTGATAGTCCAAAGGGAGAGACTAAACGTCCTCGTAGTGCCAATGAATACAAAAATAATCTTA
AAGCAAGCAGTTCAAATCCTTCAAACGATAAGCAAGTTATCCAACAAGAGAATGGTAAAGCTGATTTACG
AGCAACACCTGTTATGTTAAAAGTTTTTCAGTTAACAGATAAATCCTTGTTCTTAAGTAGTACATACGAT
GATTTTCGCGGGAGCGACTTTACTGACTCCTTAGGCAAAACCTATATATCTAATATTGATCTAATTATTG
CACCAAACCAATTTAGATTTATTGAACCAGAAGCATTAAATGAAAAAACTCACTATATTGGCGTTGTTGC
CTTATTTAATGGATATGAAAATAGAAAATGGAAAGGTATTGTCCAAGTAAGACCAAAAGGCGGCGAAAGC
TATCCATTATTAATTCGTGTGCTAGATTCTAAGGTTGAAATCTATAAGGATAATTAA