SecReT6
Protein ID: 251793543
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1858
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1844572..1845915 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDC6AQS5
KEGG IDaap:NT05HA_1858
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-118, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|251793543|ref|YP_003008272.1| type VI secretion protein [Aggregatibacter aphrophilus NJ8700]
MSVSNRVLWKEGLFIRPQHFQQESRFFATQLKQLLDISAYSFGFEKLSFDNHQLSYGKLAISECKGAMPD
GTLFELPLTDSLPSSITIDSRFIGKIIYFSLPINTGTEIEIDYSLEDSLIDSRGEILFTEIKDTHSETGN
YAQLELIKNQYRLKSSLDDLSNYVSLPVARIKDVTPDHQVILDETFFPTALNIKAIPELIRKLSELSELI
SLRAQNLAGRMNNPEQSGVADVNDFLMLLTLNRVLPLIKTVAKSGKEHPATVYELLASLRSELATFILQE
RFSDTYYDYIHDNPALSLVPLCADIKSYLSVVTNARALPLPVVAHQYGIYTSQIKDTSLYTSSEFIIAVK
AHLQPELLKTQFVQQTKISSIEQINKLVHLQLPGVPLHALPVAPRYLPYHSGFMYFQLDKTSPYWKSIAS
SAGFGFHITGNYPGLEIEFWAIRGDLT
 
Nucleotide Sequence: 1344 bp     [Download]
>ref|NC_012913.1|:1844572-1845915 type VI secretion protein [Aggregatibacter aphrophilus NJ8700]
ATGTCTGTATCAAATCGTGTTTTGTGGAAAGAGGGGCTGTTTATCCGCCCCCAGCATTTTCAGCAAGAAA
GTCGTTTTTTTGCGACTCAGTTGAAACAACTTCTTGATATTTCAGCATATAGCTTCGGCTTTGAAAAATT
ATCTTTTGATAATCACCAGCTTTCTTATGGAAAATTAGCCATTTCTGAATGTAAAGGAGCCATGCCTGAT
GGTACACTTTTTGAACTTCCGTTAACAGACAGTTTGCCTTCATCAATTACTATTGATAGCAGGTTTATTG
GAAAAATAATTTATTTTAGTCTACCGATAAATACAGGAACCGAAATAGAAATAGATTATTCACTTGAAGA
TTCACTGATTGATTCAAGAGGTGAGATATTATTCACAGAAATTAAGGACACTCATAGTGAAACTGGCAAC
TATGCACAATTGGAATTAATTAAGAACCAATATCGCTTAAAATCATCATTAGATGATCTCAGTAATTATG
TCTCATTACCAGTCGCTAGAATTAAGGATGTTACCCCTGATCATCAAGTCATTCTAGATGAAACATTTTT
TCCTACTGCGCTTAACATAAAAGCCATTCCTGAATTAATCAGAAAATTATCTGAGTTATCAGAACTTATT
TCTTTACGAGCACAAAATCTCGCAGGTAGAATGAACAACCCAGAGCAGTCTGGCGTTGCTGATGTAAATG
ATTTCTTAATGCTATTAACATTAAATCGGGTACTCCCTTTAATAAAAACCGTTGCTAAATCTGGCAAGGA
ACACCCAGCTACAGTTTATGAATTATTGGCGTCCTTACGTAGTGAACTCGCAACATTTATATTGCAGGAA
AGATTTTCAGATACTTATTATGATTATATTCACGATAACCCTGCTCTTTCATTAGTACCTCTATGTGCTG
ATATTAAATCCTATTTAAGCGTGGTCACAAATGCTCGAGCGTTGCCATTGCCTGTGGTTGCACATCAATA
TGGCATCTATACCTCACAAATCAAAGATACATCGCTGTATACGAGTTCTGAATTCATTATTGCTGTTAAA
GCACATTTACAGCCAGAACTATTAAAAACTCAATTTGTTCAACAAACAAAGATATCCAGTATAGAGCAAA
TAAATAAATTGGTTCATCTACAATTACCTGGCGTACCCCTTCATGCATTACCTGTAGCGCCTAGATATTT
ACCTTATCACTCAGGCTTTATGTATTTTCAACTAGATAAAACTTCCCCATATTGGAAAAGTATTGCATCC
TCAGCTGGTTTTGGTTTTCATATAACCGGCAATTATCCAGGATTAGAGATTGAATTTTGGGCGATTAGAG
GAGACTTAACATGA