SecReT6
Protein ID: 251793544
SecReT6 ID352
T6SS typei1
Gene symbol-
Locus tagNT05HA_1859
StrainAggregatibacter aphrophilus NJ8700
Repliconchromosome [GenBank: NC_012913] [Browse all T6SS(s) in this replicon]
Location [Strand]1845912..1846769 [+]
ProductVasF
NoteTssL
UniProt IDC6AQS6
KEGG IDaap:NT05HA_1859
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.70E-54, Aligned region: 64..267
Protein Sequence: 285 a.a.     [Download]
>gi|251793544|ref|YP_003008273.1| VasF [Aggregatibacter aphrophilus NJ8700]
MRHNELEVIDSYDGELTNNLPIDRINITNNVPVINEKTDLLYDQVGQVDFDIDYDFQLQTASYNPLVELA
NPLLATALRMRKISQLDDISSLYTRMQNEIIALSEKVKMLNYDSAFQLSFRYCVCTFIDEMVMATPWGSR
SAWGQRSLLAYFHNETWGGEKFYSILSRTMLEPEKYHELLEFMYICLALGFKGQYALKSHGQENIQNILI
KLQKTLRPLRGYDYQRKSKTHLYERDYTVKKPLSLSRLFLGTLLIFSLIYFLYSMYLNSYSTEIINNIND
IMNKS
 
Nucleotide Sequence: 858 bp     [Download]
>ref|NC_012913.1|:1845912-1846769 VasF [Aggregatibacter aphrophilus NJ8700]
ATGAGACATAATGAATTAGAAGTAATTGATTCATATGATGGTGAGCTAACTAATAATTTACCAATAGATC
GTATTAATATTACAAATAATGTACCTGTTATAAATGAAAAAACAGATTTATTATATGATCAGGTTGGACA
GGTTGACTTTGATATAGACTATGATTTTCAACTACAAACAGCCTCTTATAATCCTCTCGTGGAATTGGCT
AACCCTTTGCTAGCCACGGCATTAAGAATGAGAAAAATTTCGCAGTTAGACGATATTTCCAGTTTGTATA
CTAGAATGCAGAATGAGATTATTGCACTAAGCGAAAAAGTTAAAATGCTTAATTATGATAGTGCATTCCA
ATTATCATTTAGGTATTGTGTTTGTACATTTATTGATGAAATGGTAATGGCAACCCCTTGGGGGAGCAGA
TCTGCTTGGGGACAGCGTTCCCTATTAGCATATTTCCATAATGAAACTTGGGGAGGGGAAAAATTTTATT
CTATTTTATCTCGAACCATGTTAGAGCCTGAAAAATATCATGAGTTACTAGAGTTCATGTATATTTGTTT
AGCATTAGGATTTAAAGGTCAATACGCCTTAAAATCACATGGCCAAGAAAATATCCAAAATATTCTTATA
AAGTTACAAAAAACATTACGTCCTTTGCGTGGCTATGATTATCAGCGAAAATCTAAGACTCATCTATACG
AACGTGATTATACGGTTAAAAAACCATTATCACTGAGTCGGTTATTCTTAGGAACATTGCTAATTTTCTC
ACTCATCTATTTTCTCTACAGTATGTATCTAAATTCTTACTCTACAGAAATCATAAACAATATTAATGAT
ATTATGAATAAATCTTAA