SecReT6
Protein ID: 253689605
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3239
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3649589..3650107 [-]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDC6DCT4
KEGG IDpct:PC1_3239
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-34, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|253689605|ref|YP_003018795.1| Hcp1 family type VI secretion system effector [Pectobacterium carotovorum subsp. carotovorum PC1]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHIVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDSTIVDIDCKMPHCQDPSKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3650107-3649589 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACGCAGGGCAACATCACCGCGGGTGCTTTCACGT
CTGATTCTGTCGGCAACATCTATGTGGAAGGCCACGAAGACGAAATGCTGGTACAGGAATTCAAACACAT
AGTCACCGTACCAACCGACCCGCAGTCTGGTCAGCCATCCGGCCAGCGCGTACACAAGCCGTTCAAATTC
ACCGTTGCGCTGAACAAAGCGGTTCCGCTGATGTACAACGCCCTGGCGTCCGGTGAAATGCTGCCGACCG
TCACCCTGAAATGGTACCGCACGTCAGTTGAAGGTAAGCAGGAGCACTTCTTCTCTACCGTGCTGACCGA
TTCCACCATCGTTGACATCGACTGCAAAATGCCACATTGCCAGGATCCGTCAAAACTGGACTACACCCAG
TTAATCGAAGTGTCGCTGGCCTATCGCAAAATTGACTGGGAGCACACGGTTGCCGGTACTTCTGGTTCCG
ATGACTGGCGTGCGCCGGTCGAAGCGTAA