SecReT6
Protein ID: 253689607
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3241
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3652030..3653466 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDC6DCT6
KEGG IDpct:PC1_3241
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.10E-40, Aligned region: 326..473
ImpA-rel_N [PF06812], Evalue: 1.10E-18, Aligned region: 39..98
Protein Sequence: 478 a.a.     [Download]
>gi|253689607|ref|YP_003018797.1| ImpA domain-containing protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MQDAQQALKVGRDPRMLPEFDALRAEINKLSHASRPDVDWMLVHDMATTIFEKQGVDLQTAIYFTLARSR
LAGLTGFTESCEFLANLIVTQWDNFWPPVHQERARIEMLDWFIARISEVVRQYAISHEHKRLVYRCERAL
QLMSEKLHNAGLSRIPRVENLLHFVEGYTHLFDETEIVIVSDDQELKKQDMQIPPMVFFHSDMEPGATVQ
SGGSSGSGQAPLPAGSILIGREKGQMKPTVLKIEAHKKQKPAWFWFVSGLLTCALPVAAMTGWQYWQDQK
ADALALLQQPAYALPAAPDHNDIRRVRIVLGEQKLQGMEGELINRYQAQLEQVKNASPFYLYQYGNGLKN
VMQQLYPDSLAVKEMERQWQIALERQQGDEPKTLGYEQARARVNDTLQQLLELERQRRTVTISYLKSKLY
DMQKDLMSDVPFGIRLRELEARKIKNQSLTPAELRAMEDELRAFNVRLYRLQQGNSAS
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3653466-3652030 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGCAAGATGCACAACAGGCCCTGAAAGTCGGCCGCGATCCACGGATGCTGCCGGAGTTTGACGCACTTC
GGGCGGAAATTAACAAGCTGAGTCACGCGTCTCGCCCTGATGTGGACTGGATGCTGGTGCACGATATGGC
CACCACCATCTTTGAAAAGCAGGGTGTGGATCTTCAGACCGCGATCTACTTTACGCTGGCGCGTTCAAGA
CTGGCGGGATTGACGGGCTTCACGGAAAGCTGTGAATTTCTGGCGAACCTGATCGTCACGCAGTGGGATA
ACTTCTGGCCGCCGGTGCATCAGGAACGGGCGCGTATCGAGATGCTGGACTGGTTTATTGCCCGCATCAG
CGAAGTGGTGCGTCAATACGCCATCAGCCATGAACACAAGCGGCTGGTTTACCGTTGCGAACGTGCGCTG
CAACTCATGAGTGAAAAGCTGCACAACGCCGGCTTGAGCCGCATCCCCCGCGTTGAGAATCTGCTGCACT
TCGTTGAAGGCTATACCCATTTGTTTGATGAAACCGAGATTGTCATTGTGTCGGACGATCAGGAATTGAA
AAAGCAGGATATGCAGATTCCGCCGATGGTGTTCTTTCATTCGGATATGGAGCCCGGCGCGACGGTGCAA
AGCGGAGGTTCATCAGGCTCGGGGCAGGCTCCATTGCCCGCAGGTAGCATTCTCATCGGACGGGAGAAAG
GGCAAATGAAGCCGACGGTATTGAAAATTGAAGCGCATAAAAAGCAGAAACCCGCATGGTTCTGGTTTGT
CTCCGGACTGCTGACCTGTGCGTTGCCCGTGGCGGCGATGACGGGCTGGCAGTATTGGCAGGATCAGAAA
GCTGATGCGCTGGCGCTATTGCAGCAGCCCGCGTACGCGTTGCCCGCTGCCCCCGATCATAATGACATTC
GCCGGGTGAGGATTGTTCTGGGTGAACAGAAATTACAGGGCATGGAAGGTGAGCTGATCAACCGCTATCA
GGCACAGTTAGAGCAGGTGAAAAATGCGTCGCCGTTTTACCTGTACCAATACGGCAACGGCTTGAAAAAC
GTGATGCAGCAGCTCTATCCCGATTCGCTGGCGGTGAAGGAAATGGAACGCCAATGGCAGATTGCGCTTG
AACGCCAACAGGGTGATGAACCGAAAACGCTGGGTTACGAACAGGCGCGCGCCAGAGTCAACGATACCTT
GCAACAACTGCTGGAACTGGAACGACAGCGCCGGACAGTGACGATTTCCTACCTGAAATCAAAGCTCTAT
GACATGCAAAAAGACCTGATGTCGGATGTCCCCTTCGGAATACGGCTGCGGGAACTTGAGGCGCGTAAAA
TCAAGAACCAGTCGCTGACGCCAGCGGAACTGCGTGCGATGGAAGACGAACTGCGCGCCTTCAATGTTCG
CTTATACCGTTTGCAGCAGGGTAATTCCGCCAGCTGA