SecReT6
Protein ID: 253689612
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3246
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3660574..3663171 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDC6DCU1
KEGG IDpct:PC1_3246
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.40E-38, Aligned region: 277..325
AAA_2 [PF07724], Evalue: 4.40E-38, Aligned region: 602..763
AAA [PF00004], Evalue: 3.70E-18, Aligned region: 219..331
AAA [PF00004], Evalue: 3.70E-18, Aligned region: 537..563
AAA [PF00004], Evalue: 3.70E-18, Aligned region: 608..726
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 219..239
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 607..725
ClpB_D2-small [PF10431], Evalue: 4.10E-11, Aligned region: 427..443
ClpB_D2-small [PF10431], Evalue: 4.10E-11, Aligned region: 769..842
AAA_16 [PF13191], Evalue: 9.70E-11, Aligned region: 135..175
AAA_16 [PF13191], Evalue: 9.70E-11, Aligned region: 196..236
AAA_16 [PF13191], Evalue: 9.70E-11, Aligned region: 257..297
AAA_16 [PF13191], Evalue: 9.70E-11, Aligned region: 429..533
AAA_16 [PF13191], Evalue: 9.70E-11, Aligned region: 582..646
AAA_16 [PF13191], Evalue: 9.70E-11, Aligned region: 673..701
AAA_22 [PF13401], Evalue: 2.10E-07, Aligned region: 218..309
AAA_22 [PF13401], Evalue: 2.10E-07, Aligned region: 606..625
AAA_22 [PF13401], Evalue: 2.10E-07, Aligned region: 669..701
DUF258 [PF03193], Evalue: 0.00011, Aligned region: 184..236
DUF258 [PF03193], Evalue: 0.00011, Aligned region: 608..623
NACHT [PF05729], Evalue: 0.00023, Aligned region: 219..246
NACHT [PF05729], Evalue: 0.00023, Aligned region: 414..449
NACHT [PF05729], Evalue: 0.00023, Aligned region: 608..631
NACHT [PF05729], Evalue: 0.00023, Aligned region: 813..837
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 216..240
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 357..396
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 522..549
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 599..625
AAA_19 [PF13245], Evalue: 0.00026, Aligned region: 802..824
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 199..233
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 271..306
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 608..628
Arch_ATPase [PF01637], Evalue: 0.00029, Aligned region: 678..693
AAA_29 [PF13555], Evalue: 0.00035, Aligned region: 214..236
AAA_29 [PF13555], Evalue: 0.00035, Aligned region: 605..629
AAA_17 [PF13207], Evalue: 0.00067, Aligned region: 219..266
AAA_17 [PF13207], Evalue: 0.00067, Aligned region: 461..511
AAA_17 [PF13207], Evalue: 0.00067, Aligned region: 608..642
Zeta_toxin [PF06414], Evalue: 0.0018, Aligned region: 216..236
Zeta_toxin [PF06414], Evalue: 0.0018, Aligned region: 405..443
Zeta_toxin [PF06414], Evalue: 0.0018, Aligned region: 606..647
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 219..243
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 430..458
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 602..636
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 767..803
RuvB_N [PF05496], Evalue: 0.0028, Aligned region: 290..299
RuvB_N [PF05496], Evalue: 0.0028, Aligned region: 489..587
RuvB_N [PF05496], Evalue: 0.0028, Aligned region: 598..626
RuvB_N [PF05496], Evalue: 0.0028, Aligned region: 675..702
RuvB_N [PF05496], Evalue: 0.0028, Aligned region: 781..814
Sigma54_activat [PF00158], Evalue: 0.003, Aligned region: 219..233
Sigma54_activat [PF00158], Evalue: 0.003, Aligned region: 607..705
IstB_IS21 [PF01695], Evalue: 0.0037, Aligned region: 213..242
IstB_IS21 [PF01695], Evalue: 0.0037, Aligned region: 482..523
IstB_IS21 [PF01695], Evalue: 0.0037, Aligned region: 607..618
Ras [PF00071], Evalue: 0.0087, Aligned region: 219..232
Ras [PF00071], Evalue: 0.0087, Aligned region: 608..649
Protein Sequence: 865 a.a.     [Download]
>gi|253689612|ref|YP_003018802.1| type VI secretion ATPase, ClpV1 family [Pectobacterium carotovorum subsp. carotovorum PC1]
MIRIELPTLVERLNPVCRHMLEEAAALCIQHQGAEIRIEHLLMKMLETPLCDVRQILKRASVDADELSSL
LLPSSVDKEFDAGYPSFSPLLVEWLQDSWLLASAEFQHTRLRSGILLLVLLMTPNRYVAGAISRPLAQIN
RELLRQQFDEWVKDSVETEVAVQSATAEQAVAATTQLSRYTQNVTESARQGQLDPVLCRDHEIDLMIDIL
SRRRKNNPIVVGEAGVGKSALIEGLALRIIAGAVPERLRDVELLTLDLGAMQAGASVKGEFEKRFKGVMQ
EVKEAPRPIILFIDEAHTLIGAGNQAGGLDVSNLLKPALARGELRTIAATTWSEYKKYVEKDAALSRRFQ
LVKVGEPNAEEATVILRGLRGIYEKAHGVLIDEDALQAAAQLSARYISGRQLPDKAIDVLDTASARVAIN
LTTPPRAVSQLQTRLRQQEMEITQLERQARIGLGNTEERLAELRDAREAGAAQLAQLEADWQQQKTQVQR
VIELRTALLDDEQAVDFDAASATAELAACEQALEALQHSSVLVSPHVDKTQIAAVIAEWTGVPLNRISQG
EMDVVTRLPEFLGESIKGQQLAIAHLHKHLLTARADLRRPGRPLGAFLLVGPSGVGKTETVVQIADLMFG
GRNYLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAF
DKGELADGEGRVIDCRNVVFFLTSNLGFQTIVNYAEQSDVLLDALYPELAAFFKPALLARMEVIPYLPLA
HDTMVEIVQGKLSRLVSLLQQRFGAEVIIEDEVPEEILRLANRSENGARMLESVIDGALLPPVSLQLLQR
LSAGEPVSRIHFRVDAGQFQTEVEG
 
Nucleotide Sequence: 2598 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3663171-3660574 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
GTGATTCGAATTGAACTGCCGACACTGGTTGAACGACTCAACCCCGTGTGCCGTCATATGCTGGAAGAAG
CGGCGGCACTCTGTATTCAGCATCAGGGTGCGGAAATCCGTATTGAGCACCTGTTGATGAAAATGCTGGA
AACGCCCCTGTGTGATGTACGCCAGATCCTCAAGCGTGCGAGCGTCGATGCGGATGAGCTGTCTTCACTG
CTTTTGCCTTCCTCCGTGGATAAGGAATTTGACGCGGGCTACCCTTCATTCTCTCCTCTGCTGGTGGAGT
GGTTGCAGGATAGCTGGCTGCTGGCGTCGGCGGAATTTCAACACACGCGTTTGCGTAGCGGCATTCTGCT
GCTGGTCTTGCTGATGACGCCAAATCGCTATGTGGCAGGCGCGATATCTCGTCCGCTGGCGCAGATCAAC
CGTGAGCTTTTACGCCAGCAGTTTGATGAATGGGTGAAGGATTCGGTTGAAACGGAAGTCGCGGTGCAAT
CGGCTACAGCCGAACAAGCCGTGGCGGCGACCACGCAGTTGTCCCGCTATACCCAAAACGTAACGGAATC
TGCCCGACAGGGACAGTTGGATCCGGTGTTGTGCCGCGACCATGAAATCGATCTGATGATCGACATTCTC
TCTCGCCGTCGTAAAAACAACCCGATTGTTGTCGGGGAGGCGGGCGTGGGTAAAAGTGCGCTGATCGAAG
GGCTGGCGCTGCGCATCATTGCGGGCGCGGTGCCGGAAAGATTGCGGGATGTCGAACTGCTTACGCTCGA
TCTGGGAGCGATGCAGGCTGGCGCCTCGGTGAAAGGTGAATTTGAGAAACGCTTCAAAGGTGTGATGCAG
GAAGTGAAAGAGGCGCCGCGCCCTATCATTCTGTTTATCGATGAAGCGCATACGCTCATCGGGGCCGGTA
ATCAGGCGGGCGGGCTGGATGTTTCCAACCTGCTCAAGCCAGCGCTGGCGCGCGGTGAACTGCGTACGAT
CGCGGCAACGACCTGGAGCGAATACAAAAAATACGTGGAGAAGGACGCCGCGCTTTCCCGTCGTTTCCAA
CTCGTCAAAGTGGGTGAGCCGAACGCGGAAGAAGCCACGGTTATCTTACGCGGGCTGCGCGGCATCTATG
AAAAGGCGCACGGCGTCCTGATTGATGAAGATGCGCTTCAGGCGGCGGCACAGCTGTCGGCGCGTTATAT
CTCCGGCCGTCAACTGCCGGATAAGGCGATTGACGTGCTGGATACCGCCAGCGCGCGCGTCGCCATTAAC
CTGACGACGCCACCGCGTGCGGTCAGCCAGCTCCAGACTCGCCTGCGCCAGCAGGAGATGGAAATCACCC
AGCTTGAGCGTCAGGCGCGTATCGGCTTGGGCAATACCGAAGAGCGGTTAGCGGAACTGCGTGACGCCCG
TGAGGCCGGCGCGGCACAGCTGGCGCAGTTGGAAGCCGATTGGCAGCAGCAGAAAACGCAGGTTCAGCGC
GTGATTGAACTGCGTACCGCGCTGCTGGATGACGAGCAGGCTGTCGATTTTGATGCAGCATCGGCGACGG
CGGAGCTGGCCGCCTGTGAACAGGCGCTGGAAGCACTGCAACACTCCTCCGTTCTGGTCTCCCCTCACGT
TGATAAAACGCAGATTGCGGCGGTTATTGCCGAGTGGACGGGCGTGCCGCTGAATCGCATCTCACAGGGT
GAAATGGATGTCGTCACGCGCCTGCCTGAATTCCTGGGCGAGTCGATTAAAGGGCAGCAGTTGGCGATTG
CCCACCTGCATAAACACCTACTGACCGCGCGCGCCGATCTACGTCGTCCGGGGCGTCCGCTGGGGGCTTT
CCTGCTGGTGGGGCCGAGCGGTGTGGGTAAAACGGAAACCGTGGTGCAGATCGCCGACCTGATGTTTGGC
GGACGTAACTATCTGACCACTATCAATATGTCCGAGTATCAGGAGAAACACACGGTTTCACGTCTGATCG
GGTCACCGCCGGGCTATGTCGGGTTTGGTGAAGGAGGCGTCTTGACCGAAGCTATCCGCCAGAAACCGTA
TTCCGTGGTACTGCTGGATGAAGTGGAAAAGGCGCATCCCGATGTCCTGAACCTGTTCTATCAGGCGTTT
GATAAAGGTGAACTCGCCGATGGCGAAGGCCGAGTGATCGACTGTCGCAACGTGGTGTTCTTCCTGACGT
CCAACCTCGGGTTCCAAACGATCGTGAATTACGCTGAGCAGTCGGATGTGTTGCTGGACGCGCTCTATCC
CGAACTGGCGGCCTTCTTTAAACCTGCGCTGTTGGCGCGCATGGAAGTCATTCCGTACCTGCCGCTGGCG
CATGACACCATGGTCGAAATTGTACAGGGCAAACTGTCGCGTCTGGTGTCTCTGCTGCAACAGCGCTTTG
GCGCGGAAGTCATTATTGAAGACGAGGTGCCGGAAGAGATTCTGCGGTTGGCGAACCGCAGCGAAAATGG
GGCGCGTATGCTCGAATCGGTGATTGATGGTGCCTTGCTGCCGCCGGTTTCGCTACAGCTGCTGCAACGC
CTGTCTGCGGGCGAACCCGTCAGCCGCATTCATTTCCGCGTCGACGCCGGCCAGTTCCAGACTGAGGTGG
AGGGCTGA