SecReT6
Protein ID: 253689613
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3247
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3663185..3663961 [-]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDC6DCU2
KEGG IDpct:PC1_3247
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-71, Aligned region: 38..242
Protein Sequence: 258 a.a.     [Download]
>gi|253689613|ref|YP_003018803.1| type IV / VI secretion system protein, DotU family [Pectobacterium carotovorum subsp. carotovorum PC1]
MSIEVIKNDQLGDLLFDHARQLDMDSDYWFRLRGQSINPMIDAVTPLLGMVERVRQLSAYEGVEDLYQRV
VSEIQAIEQELHSHGYENGVILSFRYILCTFIDEAVMGREWGGQSMWSAHSLLTRFHNETWGGEKVFVLL
EKLLDDPARYRDILEFIYLCLCLGFEGRYRVMTQGREELNRVVSKLHDTLRPEPADSPTVFHLNLGQQAS
RYHLRRQVSLRTLFIGVCVVLVAAFGLYRYQLTHQTQDVLRQLGELLQ
 
Nucleotide Sequence: 777 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3663961-3663185 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGAGCATCGAGGTGATTAAAAACGATCAACTGGGAGATCTGCTGTTTGATCATGCCCGACAGCTGGATA
TGGACTCCGACTACTGGTTTCGCCTGCGCGGGCAAAGCATCAATCCGATGATTGATGCGGTCACGCCGCT
ATTGGGCATGGTGGAGCGGGTACGCCAGCTCTCCGCCTACGAGGGCGTAGAGGATCTCTATCAGCGCGTG
GTGTCTGAAATTCAGGCTATTGAGCAGGAGTTACATTCTCATGGCTACGAAAACGGCGTGATTCTGTCGT
TCCGCTACATCCTCTGCACCTTCATTGATGAAGCCGTAATGGGGCGGGAATGGGGCGGGCAGAGCATGTG
GTCGGCCCATTCTCTGCTGACCCGTTTTCACAATGAGACCTGGGGCGGCGAAAAGGTATTTGTCCTGCTG
GAGAAGCTACTGGATGACCCGGCACGCTATCGCGACATTCTGGAGTTTATTTACCTCTGCCTCTGCCTAG
GTTTTGAAGGGCGCTATCGGGTGATGACTCAGGGGCGTGAGGAACTCAATCGCGTCGTGAGCAAGTTGCA
TGACACGCTGCGCCCTGAGCCCGCGGATTCTCCGACCGTCTTCCACCTGAATCTGGGGCAACAGGCCTCG
CGCTACCACCTGCGCAGACAGGTGTCATTGCGCACGCTGTTCATTGGCGTGTGTGTGGTTCTGGTGGCCG
CATTCGGCCTGTACCGTTACCAGCTAACTCATCAAACCCAGGACGTACTGCGTCAGCTGGGAGAATTATT
ACAATAA