SecReT6
Protein ID: 253689614
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3248
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3663977..3665314 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDC6DCU3
KEGG IDpct:PC1_3248
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-160, Aligned region: 19..443
Protein Sequence: 445 a.a.     [Download]
>gi|253689614|ref|YP_003018804.1| type VI secretion protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MSSRNRIIWREGLFIKPQHFQQQQRHTDYALHARLSALSDYFYGLQSLAINEEYLNFGRIALVNASGVMP
DGTVFNIPGDDALPLPLEITDVALANQKVYLALPLAVNGVSEVGQPGQGIASRLQSHRHDVRDLHSDGGD
IVSLEVGKVSLRLMLDRDDRSAYASLAIANILDKRPDGGLILDPNFMPCSISVTAIPTLKRFLGESAGLV
AERARSLAQRIAAPGQQGVADVAEFMMLQLLNRAQPKLSHLARLGTLHPERLHETLVELCGELMTFTDES
RLPPEFPAYRHEHQQASFEPLMMALRQALSTVLSPRAVSIQLKKQPYGVMVAMVGDAELMTSAEFVLAVR
ARMPQEHLRKQLLQQTKIASSEKIRELISLQLPGIPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWQMLVS
GNTLAFHIAGEFPELDMQLWAIRGQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3665314-3663977 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGTCGAGTCGCAATCGCATTATCTGGCGGGAAGGCCTGTTCATTAAACCGCAGCATTTTCAACAGCAGC
AAAGACACACCGATTACGCACTGCATGCGCGTCTCAGCGCTCTCAGTGATTATTTCTATGGCTTGCAGTC
GCTGGCGATTAACGAGGAATACCTCAATTTTGGCCGTATCGCGCTGGTGAACGCCAGCGGGGTGATGCCG
GACGGCACCGTGTTCAATATTCCGGGTGATGACGCTCTGCCACTGCCGCTGGAAATTACCGATGTGGCGC
TGGCAAACCAGAAAGTGTATCTGGCGTTGCCGCTGGCGGTGAATGGCGTCAGTGAAGTCGGTCAGCCGGG
GCAGGGGATCGCCAGCCGCTTGCAATCGCATCGACATGACGTGCGCGATCTGCACAGCGACGGCGGCGAT
ATCGTTTCTCTGGAGGTCGGTAAGGTCAGCCTGCGTCTGATGCTCGATCGTGACGATCGCAGCGCTTATG
CCTCGCTGGCGATTGCCAACATTCTGGATAAACGTCCTGACGGCGGCTTAATTCTGGATCCTAACTTCAT
GCCGTGCAGCATCAGCGTCACGGCTATTCCCACCTTAAAACGCTTTTTGGGGGAGTCCGCCGGTCTGGTG
GCGGAGCGTGCGCGCAGTCTGGCGCAGCGTATTGCTGCACCGGGACAGCAGGGCGTCGCGGATGTCGCTG
AATTTATGATGCTGCAATTACTTAACCGCGCGCAGCCCAAACTGTCGCATCTGGCGCGTCTGGGCACTTT
GCACCCTGAACGCCTGCACGAAACGCTGGTTGAACTGTGCGGCGAACTGATGACGTTCACCGATGAATCG
CGCCTGCCGCCGGAATTCCCTGCCTACCGCCACGAGCACCAGCAGGCCAGCTTTGAGCCGCTGATGATGG
CGCTGCGTCAGGCGCTGAGCACCGTGCTGTCGCCGCGCGCCGTTTCCATCCAACTGAAGAAACAGCCGTA
TGGCGTGATGGTAGCAATGGTCGGTGATGCGGAATTGATGACCAGCGCCGAGTTTGTGCTGGCGGTACGC
GCGCGCATGCCGCAGGAGCACCTGCGTAAACAGCTGTTGCAACAAACGAAGATCGCCTCCAGCGAGAAGA
TCCGTGAACTGATCAGCCTGCAACTGCCGGGAATCCCGCTACTGCCGCTGCCGGTGGCACCGCGCCAACT
GCCTTATCACGCAGGTTACAGCTATTTCCAACTGGATAGACAAAGCCCCGCCTGGCAGATGCTGGTGTCC
GGCAATACGTTGGCGTTCCACATTGCTGGTGAATTCCCTGAGCTGGATATGCAGCTTTGGGCGATCCGCG
GCCAGTAG