SecReT6
Protein ID: 253689615
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3249
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3665317..3665838 [-]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDC6DCU4
KEGG IDpct:PC1_3249
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-36, Aligned region: 11..164
Protein Sequence: 173 a.a.     [Download]
>gi|253689615|ref|YP_003018805.1| type VI secretion lipoprotein, VC_A0113 family [Pectobacterium carotovorum subsp. carotovorum PC1]
MLRALCLCSLMFVLSGCTTLGKMAQVAANPDIQVGSNNHQPSTVGFSLLAEPDVNPNDSGEAAPIEFQLV
LLAEDSRLLATDYDQVTTDIEKALAKNYINHQDYTLLPGQFKYLPPEALDEKVHYLGVIARYADSESSEW
RKVIKLKNTGQTYQILVHLRRDEVEIKKDQEEE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3665838-3665317 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
ATGCTGCGAGCATTGTGCTTATGTTCCCTGATGTTCGTGCTGTCAGGGTGCACCACGCTGGGCAAGATGG
CGCAGGTGGCGGCGAATCCTGACATTCAGGTTGGCAGCAACAATCATCAGCCTTCTACCGTGGGTTTCAG
CCTGTTGGCGGAGCCGGACGTTAACCCGAACGACAGCGGTGAAGCCGCGCCTATCGAATTCCAACTGGTT
CTGCTGGCTGAAGATTCACGTCTGTTGGCCACCGATTACGATCAGGTAACGACGGATATCGAAAAGGCGT
TAGCCAAGAATTACATCAATCATCAGGACTACACGCTGCTGCCGGGACAGTTCAAATACCTGCCGCCTGA
AGCGCTGGATGAAAAGGTGCATTACCTCGGTGTGATCGCGCGCTATGCGGATTCGGAAAGCTCGGAATGG
CGCAAAGTCATCAAGCTAAAAAATACCGGGCAAACGTATCAGATCCTCGTGCACCTGCGCCGGGATGAAG
TCGAAATCAAAAAAGACCAAGAAGAAGAATAA