SecReT6
Protein ID: 253689616
SecReT6 ID353
T6SS typei1
Gene symbol-
Locus tagPC1_3250
StrainPectobacterium carotovorum subsp. carotovorum PC1
Repliconchromosome [GenBank: NC_012917] [Browse all T6SS(s) in this replicon]
Location [Strand]3665838..3667058 [-]
Productputative FHA domain-containing protein
NoteFha
UniProt IDC6DCU5
KEGG IDpct:PC1_3250
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.60E-05, Aligned region: 33..100
Protein Sequence: 406 a.a.     [Download]
>gi|253689616|ref|YP_003018806.1| putative FHA domain-containing protein [Pectobacterium carotovorum subsp. carotovorum PC1]
MNVTHPLTLVVLNSEQLDINSQVQHQFDHRGGTLGASEKDQWQLRDRLGAVVPAHARIDMTDGYFSLCDL
SGQSFINGSLSPIGRDRKVILSHGDELVIGPFRLGVYIGDPTTEQDIDQVLGQRTDDVLGGWLSDDKKGR
STDLADPSVTLNDPLWALQKEQSQPLLPSDSETVGESLTTSLSSFSSGEDTMDQKFVELPTINTPYAGEG
LEGYNDGTSLAPLMRGLGMSLQPGDDARLREMLEEMGKSLRAMVEGLLALQTEQAAMADTHLRPIEDNPL
RLGLGYTDTLSVLFAEGKSPVHLSAPAAVEEVLNNVRVHHIANQQAIAVALENILQAFSPAALLNRFEHY
RRSGEPLAADDGWAWQMYQHYYRELTSPRQQGFQKLFHQVYAQAYDRAVRQQQEQK
 
Nucleotide Sequence: 1221 bp     [Download]
>gi|253686409|ref|NC_012917.1|:c3667058-3665838 Pectobacterium carotovorum subsp. carotovorum PC1, complete genome
GTGAACGTAACCCACCCACTCACGTTGGTTGTGCTCAACAGTGAGCAGCTCGATATCAATTCTCAGGTAC
AGCACCAGTTCGATCACCGTGGTGGCACGCTGGGCGCGTCGGAAAAAGACCAGTGGCAACTGCGGGATCG
GCTGGGTGCCGTGGTCCCGGCACATGCCCGTATCGACATGACCGATGGTTATTTCAGCCTGTGCGATCTG
AGCGGCCAGTCTTTTATTAACGGATCGCTGTCGCCGATTGGGCGAGATCGCAAAGTTATTTTGTCGCACG
GTGATGAACTGGTGATTGGGCCTTTCCGGCTGGGCGTGTACATCGGCGATCCCACCACGGAACAGGATAT
CGATCAGGTATTAGGACAGCGCACCGACGATGTGCTGGGCGGCTGGCTGAGTGACGATAAAAAAGGGCGG
TCTACGGATCTGGCGGATCCCTCGGTCACGTTGAATGACCCGCTGTGGGCGCTACAGAAAGAACAGAGCC
AGCCACTATTGCCATCAGACAGTGAGACGGTCGGAGAATCGCTCACGACCTCTCTTTCTTCTTTTTCTTC
TGGTGAGGACACCATGGATCAGAAATTTGTGGAACTACCGACCATCAACACACCGTACGCGGGAGAAGGG
CTGGAGGGCTACAACGATGGCACCTCGCTGGCACCGCTGATGCGCGGGCTGGGGATGTCGCTTCAGCCGG
GCGATGATGCGCGATTGCGTGAAATGCTGGAAGAGATGGGAAAAAGCCTACGTGCGATGGTGGAAGGCCT
GCTGGCATTGCAGACGGAACAGGCGGCAATGGCGGATACGCATTTACGCCCGATTGAAGATAACCCGCTG
CGTTTGGGGCTGGGCTATACCGATACGCTGTCGGTGCTGTTTGCTGAAGGAAAAAGTCCGGTACACCTGT
CTGCGCCCGCTGCCGTGGAAGAAGTGTTGAACAATGTGCGGGTGCATCACATCGCGAATCAGCAAGCGAT
TGCCGTCGCGTTGGAAAATATTCTTCAGGCTTTCTCGCCTGCCGCGTTGCTCAACCGCTTTGAACACTAT
CGCCGCAGCGGCGAGCCACTGGCGGCGGATGACGGCTGGGCATGGCAGATGTATCAGCACTACTACCGCG
AATTAACGTCGCCGCGCCAGCAGGGCTTCCAAAAACTGTTCCATCAGGTGTATGCGCAGGCGTATGACCG
CGCCGTGCGTCAGCAGCAGGAGCAAAAATAA